(data stored in ACNUC7421 zone)

EMBL: CP001825.PE66

CP001825.PE66        Location/Qualifiers
FT   CDS             complement(68690..69217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0067"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   afw:Anae109_4485 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40990"
FT                   /db_xref="GOA:D1CDI4"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI4"
FT                   /inference="protein motif:TFAM:TIGR01144"
FT                   /protein_id="ACZ40990.1"
FT                   /translation="MSAVLENLGLQLWPFIWQLVAFLILVYVLKRFAFGPVTRILDERA
FT                   ARVRESIETAERIQREAAEQEQRTKQMLEDARRQAQAILQQAQQAAERIQSTAQDNARE
FT                   QANQIIQRAQEDIDRMKAEAIDELRRQVADLAIAAASRIIRKELDPATHRALINEVLAE
FT                   SVDQFRGGRPVA"
     MSAVLENLGL QLWPFIWQLV AFLILVYVLK RFAFGPVTRI LDERAARVRE SIETAERIQR        60
     EAAEQEQRTK QMLEDARRQA QAILQQAQQA AERIQSTAQD NAREQANQII QRAQEDIDRM       120
     KAEAIDELRR QVADLAIAAA SRIIRKELDP ATHRALINEV LAESVDQFRG GRPVA            175
//

If you have problems or comments...

PBIL Back to PBIL home page