(data stored in ACNUC7421 zone)

EMBL: CP001825.PE67

CP001825.PE67        Location/Qualifiers
FT   CDS             complement(69324..69635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0068"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   sat:SYN_02965 ATP synthase C chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40991"
FT                   /db_xref="GOA:D1CDI5"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI5"
FT                   /inference="protein motif:TFAM:TIGR01260"
FT                   /protein_id="ACZ40991.1"
FT                   /translation="MDLGVLTDLSNTIVAAAQNAPALQEQAANLTQFKGFASAIAIGVG
FT                   ALGPGLGIGLAVRGAMEATGRNPEASGDIRTTLIIGAALAEAVAIYAFLTALLILFTT"
     MDLGVLTDLS NTIVAAAQNA PALQEQAANL TQFKGFASAI AIGVGALGPG LGIGLAVRGA        60
     MEATGRNPEA SGDIRTTLII GAALAEAVAI YAFLTALLIL FTT                         103
//

If you have problems or comments...

PBIL Back to PBIL home page