(data stored in ACNUC7421 zone)

EMBL: CP001825.PE68

CP001825.PE68        Location/Qualifiers
FT   CDS             complement(69681..70535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0069"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   rce:RC1_0365 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40992"
FT                   /db_xref="GOA:D1CDI6"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDI6"
FT                   /inference="protein motif:TFAM:TIGR01131"
FT                   /protein_id="ACZ40992.1"
FT                   /translation="MPLMLAEQRVGGLARILAQEEEHGKGLLGTPFHQPTLAPETLFHI
FT                   GPIPVTNSMLMTLIVVVALSIAAIWLSRGLSLVPSKRQNFLEAIVELLDNLVQTTAGRT
FT                   AGRAILPLIGTLFIYILVANWASLLPGVGTITWHTEHGDVPLLRAPNADLNMTLAMAIV
FT                   TIVVVQIAGVAAHGVGGHFKEYLNPMHLIDELARVISLSVRLFANVFGGEVLLTVMLAL
FT                   SFLGAIAIIPVVIPMAFMGLEMFIGLIQALVFSLLSLIYITLAVAGHGHPADAEDAESA
FT                   THH"
     MPLMLAEQRV GGLARILAQE EEHGKGLLGT PFHQPTLAPE TLFHIGPIPV TNSMLMTLIV        60
     VVALSIAAIW LSRGLSLVPS KRQNFLEAIV ELLDNLVQTT AGRTAGRAIL PLIGTLFIYI       120
     LVANWASLLP GVGTITWHTE HGDVPLLRAP NADLNMTLAM AIVTIVVVQI AGVAAHGVGG       180
     HFKEYLNPMH LIDELARVIS LSVRLFANVF GGEVLLTVML ALSFLGAIAI IPVVIPMAFM       240
     GLEMFIGLIQ ALVFSLLSLI YITLAVAGHG HPADAEDAES ATHH                        284
//

If you have problems or comments...

PBIL Back to PBIL home page