(data stored in ACNUC7421 zone)

EMBL: CP001825.PE72

CP001825.PE72        Location/Qualifiers
FT   CDS             complement(74062..75096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0074"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="KEGG: rru:Rru_A2819 RecA protein; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40996"
FT                   /db_xref="GOA:D1CDJ0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ0"
FT                   /inference="protein motif:TFAM:TIGR02012"
FT                   /protein_id="ACZ40996.1"
FT                   /translation="MSDRDKALESAIAQIERAFGTGSIMRMTGDRAKMQIEAIPTGSIA
FT                   LDIALGVGGVPRGRIVEIYGPESSGKTTLAQHIIAEAQKLGGTAAYIDAEHAFDPSYAE
FT                   KCGVQLSDLLISQPDTGEQALEIAETLVRSGAVDVVVIDSVAALVPRAEIEGEMGDSHV
FT                   GLQARLMSQALRKLAGAVNKSKTVLIFINQIRMKIGVMFGNPETTSGGNALKFYASVRL
FT                   EIRKVESIKQGQDVVGNRVRVKVIKNKVASPYRTAEFDIMFNEGISKEGNLIDVGLSVG
FT                   VLRKSGSFIYLDDERLGQGRENAKEYLRQNPDVAEEIESRIKAAGNLDKVLIGSNGGLS
FT                   DIDV"
     MSDRDKALES AIAQIERAFG TGSIMRMTGD RAKMQIEAIP TGSIALDIAL GVGGVPRGRI        60
     VEIYGPESSG KTTLAQHIIA EAQKLGGTAA YIDAEHAFDP SYAEKCGVQL SDLLISQPDT       120
     GEQALEIAET LVRSGAVDVV VIDSVAALVP RAEIEGEMGD SHVGLQARLM SQALRKLAGA       180
     VNKSKTVLIF INQIRMKIGV MFGNPETTSG GNALKFYASV RLEIRKVESI KQGQDVVGNR       240
     VRVKVIKNKV ASPYRTAEFD IMFNEGISKE GNLIDVGLSV GVLRKSGSFI YLDDERLGQG       300
     RENAKEYLRQ NPDVAEEIES RIKAAGNLDK VLIGSNGGLS DIDV                        344
//

If you have problems or comments...

PBIL Back to PBIL home page