(data stored in ACNUC7421 zone)

EMBL: CP001825.PE73

CP001825.PE73        Location/Qualifiers
FT   CDS             75247..75729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0075"
FT                   /product="protein of unknown function DUF456"
FT                   /note="PFAM: protein of unknown function DUF456; KEGG:
FT                   ppd:Ppro_1793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40997"
FT                   /db_xref="GOA:D1CDJ1"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ1"
FT                   /inference="protein motif:PFAM:PF04306"
FT                   /protein_id="ACZ40997.1"
FT                   /translation="MNEIAFLLGLTLILVGLVGIMIPFIPGIPIMWLGALVYGAMTGFR
FT                   ELTWPWMLIITLIALISISLDFILSAIMARKFGGSRLASFGSLLGGILGTLYLGAFGAL
FT                   LGAFGGAALTDLPVSRSIRKALRSGTGAVVGFVLALIVDLTSGIAILAIYLLTAIS"
     MNEIAFLLGL TLILVGLVGI MIPFIPGIPI MWLGALVYGA MTGFRELTWP WMLIITLIAL        60
     ISISLDFILS AIMARKFGGS RLASFGSLLG GILGTLYLGA FGALLGAFGG AALTDLPVSR       120
     SIRKALRSGT GAVVGFVLAL IVDLTSGIAI LAIYLLTAIS                             160
//

If you have problems or comments...

PBIL Back to PBIL home page