(data stored in ACNUC7421 zone)

EMBL: CP001825.PE75

CP001825.PE75        Location/Qualifiers
FT   CDS             complement(77824..79302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0077"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase class Ic; KEGG: gsu:GSU1219
FT                   glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ40999"
FT                   /db_xref="GOA:D1CDJ3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ3"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ACZ40999.1"
FT                   /translation="MNSEVRVRFPPSPTGYLHVGNLRTAVFNWLLARHHGGKFILRIED
FT                   TDRARVVPGAVEVIYETLRWIGIDWDEGPDIGGPHAPYVQSERKEIYREYAELLISQGK
FT                   AYRCFCSQERLEALREEQRKNNLPTRYDRKCRYLGPEEAKRLVDSGQPYVVRFATPLEG
FT                   TTTMVDLLRGPVTYQNDQIDDFVILKSDGYPPYHFAVVVDDHLMGITHVLRGDEYISSG
FT                   ARDILLHEALGWNPPLYAHTAIILGPDRSRLSKRHGALPALEYRDIGIIPEAMFNYLAL
FT                   LGASYSADREIFSREELIELFDIDKMSPSPAIFDANKLEWMNAYYINHVLSVDDLASRV
FT                   KPILENAGLVKTEDLDEGYLIEVIGLVKDRIKLLPDVVELTDFFFRDPDPSAEEIAGKK
FT                   LTLQEAQELLQKVKDRVSPIDNWSEEILETELRSMASELGVKTGTLFMLIRVAITGKTA
FT                   SPGLFETMAVLGKDRTISRIGRAIDKLDLVVHGG"
     MNSEVRVRFP PSPTGYLHVG NLRTAVFNWL LARHHGGKFI LRIEDTDRAR VVPGAVEVIY        60
     ETLRWIGIDW DEGPDIGGPH APYVQSERKE IYREYAELLI SQGKAYRCFC SQERLEALRE       120
     EQRKNNLPTR YDRKCRYLGP EEAKRLVDSG QPYVVRFATP LEGTTTMVDL LRGPVTYQND       180
     QIDDFVILKS DGYPPYHFAV VVDDHLMGIT HVLRGDEYIS SGARDILLHE ALGWNPPLYA       240
     HTAIILGPDR SRLSKRHGAL PALEYRDIGI IPEAMFNYLA LLGASYSADR EIFSREELIE       300
     LFDIDKMSPS PAIFDANKLE WMNAYYINHV LSVDDLASRV KPILENAGLV KTEDLDEGYL       360
     IEVIGLVKDR IKLLPDVVEL TDFFFRDPDP SAEEIAGKKL TLQEAQELLQ KVKDRVSPID       420
     NWSEEILETE LRSMASELGV KTGTLFMLIR VAITGKTASP GLFETMAVLG KDRTISRIGR       480
     AIDKLDLVVH GG                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page