(data stored in ACNUC7421 zone)

EMBL: CP001825.PE76

CP001825.PE76        Location/Qualifiers
FT   CDS             79436..80785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0078"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase; KEGG:
FT                   gsu:GSU0493 pyridine nucleotide-disulphide oxidoreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41000"
FT                   /db_xref="GOA:D1CDJ4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ4"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACZ41000.1"
FT                   /translation="MTVGARIDLLSKGHRSQTEEEYRKASYKILILGAGFGGIQAAIEL
FT                   DKHLGKRQDVSILVVDRDNTQLFQPLLWTVASGKNCPDDTTVPIRKFQKGRSFHVMHSA
FT                   VKHIDLQNQVVYFDNGEDRPFDFLVIALGSVTAIPDLPGLRERALLFRSPADAIELRNK
FT                   VIDALEMAHKEQDPEARKSWLTFVVGGGGDTGIELAATLKEYIYAGLFAEYPWLENEPA
FT                   RIVLVSRSSRLVPQSRPHISKTVQEVLEHEGIEVMNNTSVEAVTEDEVKTSAGTIKART
FT                   LFWAAGITAPKVVKDLPVEHARNGSLIVDKFLRIPQYPNVFVVGDSAWAFDARTNDPIP
FT                   PTAQAAEHMGRYVGRTISSLIQNRSIKPFVFKPLGHLALLGQRTGVAEVGPLTFTGIPA
FT                   WFIWHSYYLIHIPSWQNRIYLFTHWLLSLILGRETGQLRLSPGVLKEGIQ"
     MTVGARIDLL SKGHRSQTEE EYRKASYKIL ILGAGFGGIQ AAIELDKHLG KRQDVSILVV        60
     DRDNTQLFQP LLWTVASGKN CPDDTTVPIR KFQKGRSFHV MHSAVKHIDL QNQVVYFDNG       120
     EDRPFDFLVI ALGSVTAIPD LPGLRERALL FRSPADAIEL RNKVIDALEM AHKEQDPEAR       180
     KSWLTFVVGG GGDTGIELAA TLKEYIYAGL FAEYPWLENE PARIVLVSRS SRLVPQSRPH       240
     ISKTVQEVLE HEGIEVMNNT SVEAVTEDEV KTSAGTIKAR TLFWAAGITA PKVVKDLPVE       300
     HARNGSLIVD KFLRIPQYPN VFVVGDSAWA FDARTNDPIP PTAQAAEHMG RYVGRTISSL       360
     IQNRSIKPFV FKPLGHLALL GQRTGVAEVG PLTFTGIPAW FIWHSYYLIH IPSWQNRIYL       420
     FTHWLLSLIL GRETGQLRLS PGVLKEGIQ                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page