(data stored in ACNUC7421 zone)

EMBL: CP001825.PE77

CP001825.PE77        Location/Qualifiers
FT   CDS             80951..82498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0079"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein SecD;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: bja:bll4735
FT                   preprotein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41001"
FT                   /db_xref="GOA:D1CDJ5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:D1CDJ5"
FT                   /inference="protein motif:TFAM:TIGR01129"
FT                   /protein_id="ACZ41001.1"
FT                   /translation="MRRSTLYSLIFIIILTAFAVWVDLPGSRNVFGRQAEVVEGLDLQG
FT                   GLQVLLQARHVGGKAPTREQMEEVRQVVEQRVNSLGLTEPVVQLQGSDRIVVELPGVKD
FT                   PEQAIRTFQGTGLLEFIDAGDTPLQVGTLVNTTLGPAITNGNQNQNSTKNGTPTPGTTP
FT                   TPESTPQANQTPVAANVTPTPEDPQFQQALQATPPEQLQRTYTTVITGNDIANARPDFD
FT                   PTTGEPVVSFELKPEAAKKFADFTTQNVGKYLAIALDKKIISSPQIRDPITNGRGVITG
FT                   VTREEARTLAIQIRSGSLSVPLDIISSNTVGATLGNDSVQRSIRAGLIGIGAVALFMIL
FT                   YYRLPGFVSVVALAIYAAVVFALFKLIPVTLTLAGIAGFILSVGMAVDANVLIFARLKD
FT                   ELRRGRGLIQAIDVGFKNAWPSIRDSNISTLITCAILIWFGSRFGASVIKGFAITLAIG
FT                   VIVSMFTAIFVTRTLLQVVLSMVHTRNLWIWGIGKNQLPEPEGRTLQPAKSSRTTQA"
     MRRSTLYSLI FIIILTAFAV WVDLPGSRNV FGRQAEVVEG LDLQGGLQVL LQARHVGGKA        60
     PTREQMEEVR QVVEQRVNSL GLTEPVVQLQ GSDRIVVELP GVKDPEQAIR TFQGTGLLEF       120
     IDAGDTPLQV GTLVNTTLGP AITNGNQNQN STKNGTPTPG TTPTPESTPQ ANQTPVAANV       180
     TPTPEDPQFQ QALQATPPEQ LQRTYTTVIT GNDIANARPD FDPTTGEPVV SFELKPEAAK       240
     KFADFTTQNV GKYLAIALDK KIISSPQIRD PITNGRGVIT GVTREEARTL AIQIRSGSLS       300
     VPLDIISSNT VGATLGNDSV QRSIRAGLIG IGAVALFMIL YYRLPGFVSV VALAIYAAVV       360
     FALFKLIPVT LTLAGIAGFI LSVGMAVDAN VLIFARLKDE LRRGRGLIQA IDVGFKNAWP       420
     SIRDSNISTL ITCAILIWFG SRFGASVIKG FAITLAIGVI VSMFTAIFVT RTLLQVVLSM       480
     VHTRNLWIWG IGKNQLPEPE GRTLQPAKSS RTTQA                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page