(data stored in ACNUC7421 zone)

EMBL: CP001825.PE78

CP001825.PE78        Location/Qualifiers
FT   CDS             82519..83472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0080"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="TIGRFAM: protein-export membrane protein SecF;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: bha:BH1237
FT                   preprotein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41002"
FT                   /db_xref="GOA:D1CDJ6"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:D1CDJ6"
FT                   /inference="protein motif:TFAM:TIGR00966"
FT                   /protein_id="ACZ41002.1"
FT                   /translation="MIDIVRWRYAFYLLSLLIIIPGTIYLLLFGLRLGIDFEGGTFWQI
FT                   QFEKPVRIEDVRSALAQAGYNEAFVQSFGQQSNTAQGTVTRGVSMRLPEIKENSPEKAK
FT                   LEQILKSRFGNYEELVFTSVGPAVGREIRNRSIVAIALASLGILGYIAFAFRKVSHPFR
FT                   YGICAIIAMLHDVLVVVGIFAILGKHFGVEIDALFVTALLTVIGFSVHDTIVVFDRIRE
FT                   NQLRRYGESFEQIVNISLLQTLVRSVNTSMTVIFTLLALYFFGGTTIKHFVLALLIGIV
FT                   SGTYSSIFNASLLLVSWENKDFLRIFRRTEPEAAAT"
     MIDIVRWRYA FYLLSLLIII PGTIYLLLFG LRLGIDFEGG TFWQIQFEKP VRIEDVRSAL        60
     AQAGYNEAFV QSFGQQSNTA QGTVTRGVSM RLPEIKENSP EKAKLEQILK SRFGNYEELV       120
     FTSVGPAVGR EIRNRSIVAI ALASLGILGY IAFAFRKVSH PFRYGICAII AMLHDVLVVV       180
     GIFAILGKHF GVEIDALFVT ALLTVIGFSV HDTIVVFDRI RENQLRRYGE SFEQIVNISL       240
     LQTLVRSVNT SMTVIFTLLA LYFFGGTTIK HFVLALLIGI VSGTYSSIFN ASLLLVSWEN       300
     KDFLRIFRRT EPEAAAT                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page