(data stored in ACNUC7421 zone)

EMBL: CP001825.PE79

CP001825.PE79        Location/Qualifiers
FT   CDS             83548..85662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0081"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: AVP2; AVP2 (ARABIDOPSIS VACUOLAR H+-
FT                   PYROPHOSPHATASE 2); TIGRFAM: V-type H(+)-translocating
FT                   pyrophosphatase; PFAM: Inorganic H pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41003"
FT                   /db_xref="GOA:D1CDJ7"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDJ7"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ACZ41003.1"
FT                   /translation="MSNEVLWAILIFGAGILAVIFALSMARYVLSRDTGTPEMKAVADT
FT                   IYEGAIAYLNRQYTTIASIAVITAIIIGAIIALVGSETMDLPGPQAAIMTAIAFLAGAL
FT                   ASGVSGYIAMLVAVKSNVRTAAAARRSLGDALLVSLRGGAAGAFFIIALSIMGVAAIFY
FT                   AYNGFNQPERAPFLIVGFGFGASFVALFAQLGGGIYTKAADVGADLVGKVEAGIPEDDP
FT                   RNPAVIADLVGDNVGDCAGRGADLFESTAAENIGAMILGVSIFLATGRDNPGFIFLSLV
FT                   LGAMGLIASMIGVLSVRPSANADPMGALNRGFAVTAVLSIIGLFIATLWVLDGNWWLFG
FT                   CGLVGIITSILFLLMTQYYTSEKYRPVRTIAEASKTGPATNIISGIAIGFENTALPAIV
FT                   ISLAIGTAYFFGTRTGFSDNSFVNGVYGTAVATMGMLMTVAYVLAMDIFGPITDNAGGV
FT                   VEMSNQPEEVRERTDALDAVGNTTKALTKGYAIGSAALAAFLLFSAYLSDARLEAVNLA
FT                   RVPVFIGGFLGGMLVFLFSSLAIRAVGRAAGDMIEEVRRQFRSEPGIMQGTVRPNYAKA
FT                   VDISTRAALREMVLPGILAVGMPVVVGLILRAEAVAALLMVGTMTGILVALVLNNGGGA
FT                   WDNAKKLIESGQLLDEEGKPIGKGTATHAAAVVGDTVGDPFKDTAGPSLHVLIKLLSTV
FT                   TLVLAPLFIR"
     MSNEVLWAIL IFGAGILAVI FALSMARYVL SRDTGTPEMK AVADTIYEGA IAYLNRQYTT        60
     IASIAVITAI IIGAIIALVG SETMDLPGPQ AAIMTAIAFL AGALASGVSG YIAMLVAVKS       120
     NVRTAAAARR SLGDALLVSL RGGAAGAFFI IALSIMGVAA IFYAYNGFNQ PERAPFLIVG       180
     FGFGASFVAL FAQLGGGIYT KAADVGADLV GKVEAGIPED DPRNPAVIAD LVGDNVGDCA       240
     GRGADLFEST AAENIGAMIL GVSIFLATGR DNPGFIFLSL VLGAMGLIAS MIGVLSVRPS       300
     ANADPMGALN RGFAVTAVLS IIGLFIATLW VLDGNWWLFG CGLVGIITSI LFLLMTQYYT       360
     SEKYRPVRTI AEASKTGPAT NIISGIAIGF ENTALPAIVI SLAIGTAYFF GTRTGFSDNS       420
     FVNGVYGTAV ATMGMLMTVA YVLAMDIFGP ITDNAGGVVE MSNQPEEVRE RTDALDAVGN       480
     TTKALTKGYA IGSAALAAFL LFSAYLSDAR LEAVNLARVP VFIGGFLGGM LVFLFSSLAI       540
     RAVGRAAGDM IEEVRRQFRS EPGIMQGTVR PNYAKAVDIS TRAALREMVL PGILAVGMPV       600
     VVGLILRAEA VAALLMVGTM TGILVALVLN NGGGAWDNAK KLIESGQLLD EEGKPIGKGT       660
     ATHAAAVVGD TVGDPFKDTA GPSLHVLIKL LSTVTLVLAP LFIR                        704
//

If you have problems or comments...

PBIL Back to PBIL home page