(data stored in ACNUC7421 zone)

EMBL: CP001825.PE85

CP001825.PE85        Location/Qualifiers
FT   CDS             95778..96719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0087"
FT                   /product="peptidase S58 DmpA"
FT                   /note="PFAM: peptidase S58 DmpA; KEGG: dac:Daci_2906
FT                   peptidase S58 DmpA"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41009"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK3"
FT                   /inference="protein motif:PFAM:PF03576"
FT                   /protein_id="ACZ41009.1"
FT                   /translation="MQDSILDVAGIEVGSSEDQTIRTGCTVVLCKQGATVGVDVRGAAP
FT                   ATRETDLCRSGNLVSKVHAILLTGGSAFGLDSASGVMRFLWERGIGFDTPATRVPIVPA
FT                   AAIYDLNVGRVGWPHSEMAYQACREATSKTMSRGRVGAGTGATVGKILGPKNCTEGGLG
FT                   SASERVGSFRVGALVVVNALGDVVDPNSGKIIAGPKDPLTGNFISTEDVLLEGRPSTSN
FT                   EGQNTTLVVVATDAPLSKEQANRLASISHDGLARVIRPAHTLVDGDVVFALSTTADNQV
FT                   VTTDQMIALGVGAIRAVERAILDAVAVKVNHR"
     MQDSILDVAG IEVGSSEDQT IRTGCTVVLC KQGATVGVDV RGAAPATRET DLCRSGNLVS        60
     KVHAILLTGG SAFGLDSASG VMRFLWERGI GFDTPATRVP IVPAAAIYDL NVGRVGWPHS       120
     EMAYQACREA TSKTMSRGRV GAGTGATVGK ILGPKNCTEG GLGSASERVG SFRVGALVVV       180
     NALGDVVDPN SGKIIAGPKD PLTGNFISTE DVLLEGRPST SNEGQNTTLV VVATDAPLSK       240
     EQANRLASIS HDGLARVIRP AHTLVDGDVV FALSTTADNQ VVTTDQMIAL GVGAIRAVER       300
     AILDAVAVKV NHR                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page