(data stored in ACNUC7421 zone)

EMBL: CP001825.PE86

CP001825.PE86        Location/Qualifiers
FT   CDS             complement(96716..97165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0088"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: ank:AnaeK_2633
FT                   Holliday junction resolvase YqgF"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41010"
FT                   /db_xref="GOA:D1CDK4"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK4"
FT                   /inference="protein motif:PFAM:PF03652"
FT                   /protein_id="ACZ41010.1"
FT                   /translation="MVVMGIDPGRKRIGIALSDPTGLLATAYKVIHRTTSDRDLEEIRR
FT                   IAEHENVEKIVVGLPLHMSGYEGEEAVRARELAKQIETATGLPVELVDERLTSVEAERR
FT                   LLESRRKLGKLGRKKLAIDAEAAAVLLQDYLDQERLRQRAIDSSL"
     MVVMGIDPGR KRIGIALSDP TGLLATAYKV IHRTTSDRDL EEIRRIAEHE NVEKIVVGLP        60
     LHMSGYEGEE AVRARELAKQ IETATGLPVE LVDERLTSVE AERRLLESRR KLGKLGRKKL       120
     AIDAEAAAVL LQDYLDQERL RQRAIDSSL                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page