(data stored in ACNUC7421 zone)

EMBL: CP001825.PE88

CP001825.PE88        Location/Qualifiers
FT   CDS             100139..101128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0090"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: mxa:MXAN_2666 pyruvate dehydrogenase complex,
FT                   E1 component, pyruvate dehydrogenase, alpha subunit;
FT                   TIGRFAM: pyruvate dehydrogenase (acetyl- transferring) E1
FT                   component, alpha subunit; PFAM: dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41012"
FT                   /db_xref="GOA:D1CDK6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK6"
FT                   /inference="protein motif:TFAM:TIGR03182"
FT                   /protein_id="ACZ41012.1"
FT                   /translation="MAKMETRTENKEQLLELYRKMLLIRHFEERAAQLYTQAYIGGYCH
FT                   LNVGEEATVVGALTSIREDDYVFTYYREHGHALTLGSDPKAVMAELCGKVTGLSKGRGG
FT                   SMHLFDKKHRLYGGYGIVGGHLPLAVGAAMAIEYKGEDSIVMCLFGEGATNIGAFHEAL
FT                   NLAKVYHLPVLFFCVNNQYAMGARVDEDSAVPEMWMKACAYNMPAEKVDGMDLFAVREV
FT                   TQRMVEKVRETREPMFLEAITYRFRGHSMADAGRYRTQEEVKQWMQRDPIHLTARRLEE
FT                   MGVLDSELKAKIESEVEQEIEEATKFAIESPDPDVSDLYKYVYTEDGE"
     MAKMETRTEN KEQLLELYRK MLLIRHFEER AAQLYTQAYI GGYCHLNVGE EATVVGALTS        60
     IREDDYVFTY YREHGHALTL GSDPKAVMAE LCGKVTGLSK GRGGSMHLFD KKHRLYGGYG       120
     IVGGHLPLAV GAAMAIEYKG EDSIVMCLFG EGATNIGAFH EALNLAKVYH LPVLFFCVNN       180
     QYAMGARVDE DSAVPEMWMK ACAYNMPAEK VDGMDLFAVR EVTQRMVEKV RETREPMFLE       240
     AITYRFRGHS MADAGRYRTQ EEVKQWMQRD PIHLTARRLE EMGVLDSELK AKIESEVEQE       300
     IEEATKFAIE SPDPDVSDLY KYVYTEDGE                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page