(data stored in ACNUC7421 zone)

EMBL: CP001825.PE90

CP001825.PE90        Location/Qualifiers
FT   CDS             102136..103377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0092"
FT                   /product="Dihydrolipoyllysine-residue succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment domain-
FT                   containing protein; E3 binding domain protein; KEGG:
FT                   mxa:MXAN_2668 pyruvate dehydrogenase complex , E2
FT                   component, dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41014"
FT                   /db_xref="GOA:D1CDK8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDK8"
FT                   /inference="protein motif:PRIAM:2.3.1.61"
FT                   /protein_id="ACZ41014.1"
FT                   /translation="MNLTMPRLSDTMEEGTVGKWLKKEGDSFKKGEAIAEIQTDKANME
FT                   LEAFQDGVIEKILVQEGQTVPVGEPIAIIRSPSEAPGPSETPTTEEPKHETKPQEPVQE
FT                   QTPQPAESPIPIAPREEAGTAGPQGRIKASPLARRIAQELGIDLATVKGTGPNGRIKRE
FT                   DVERAAASRTQAPKVEEIPAAEAAPPSRVEPFTRIQSIIAQRMVQSKTQVPHIYITIEL
FT                   DMSKAIALRQEINQLGEPPVSFNDMVIKACGLALRNYPLANASYVDGGIKYNEQVNVGF
FT                   AVATKGALYVPVIRDADKKNLRQIAAETRALINKARENKLSPQDLSGGTFTVSNLGMYG
FT                   VEEFQAVVNQPEAAILAVGAITQKPVVQDGQIVIGNRMRVTLSADHRVLYGADAAEFLN
FT                   ELRKFLENPLLLAF"
     MNLTMPRLSD TMEEGTVGKW LKKEGDSFKK GEAIAEIQTD KANMELEAFQ DGVIEKILVQ        60
     EGQTVPVGEP IAIIRSPSEA PGPSETPTTE EPKHETKPQE PVQEQTPQPA ESPIPIAPRE       120
     EAGTAGPQGR IKASPLARRI AQELGIDLAT VKGTGPNGRI KREDVERAAA SRTQAPKVEE       180
     IPAAEAAPPS RVEPFTRIQS IIAQRMVQSK TQVPHIYITI ELDMSKAIAL RQEINQLGEP       240
     PVSFNDMVIK ACGLALRNYP LANASYVDGG IKYNEQVNVG FAVATKGALY VPVIRDADKK       300
     NLRQIAAETR ALINKARENK LSPQDLSGGT FTVSNLGMYG VEEFQAVVNQ PEAAILAVGA       360
     ITQKPVVQDG QIVIGNRMRV TLSADHRVLY GADAAEFLNE LRKFLENPLL LAF              413
//

If you have problems or comments...

PBIL Back to PBIL home page