(data stored in ACNUC7421 zone)

EMBL: CP001825.PE95

CP001825.PE95        Location/Qualifiers
FT   CDS             107750..108373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0097"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: sus:Acid_0913
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41019"
FT                   /db_xref="GOA:D1CDL3"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL3"
FT                   /inference="protein motif:TFAM:TIGR00214"
FT                   /protein_id="ACZ41019.1"
FT                   /translation="MGIVPYMEAWELQKSLVASIASNEHPESLILLQHPHTYTIGRKGG
FT                   HDHLLASIEQLRAMNVEVIETDRGGDITYHGPEQIVGYPLINLRNIGSDVHKYLRMLEE
FT                   VLIRTLNDYGFSAHRDEQYTGVWIGKAKIAAIGVKISRGITMHGFAININTDLRYFDMI
FT                   IPCGITGRSVTSLQVLLGRTIPLEEVMDHIEHHFSEVFEVQITR"
     MGIVPYMEAW ELQKSLVASI ASNEHPESLI LLQHPHTYTI GRKGGHDHLL ASIEQLRAMN        60
     VEVIETDRGG DITYHGPEQI VGYPLINLRN IGSDVHKYLR MLEEVLIRTL NDYGFSAHRD       120
     EQYTGVWIGK AKIAAIGVKI SRGITMHGFA ININTDLRYF DMIIPCGITG RSVTSLQVLL       180
     GRTIPLEEVM DHIEHHFSEV FEVQITR                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page