(data stored in ACNUC7421 zone)

EMBL: CP001825.PE98

CP001825.PE98        Location/Qualifiers
FT   CDS             111270..113369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tter_0100"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   mes:Meso_1097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tter_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACZ41022"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:D1CDL6"
FT                   /inference="protein motif:PFAM:PF03747"
FT                   /protein_id="ACZ41022.1"
FT                   /translation="MSLPEDYLERVYAGVLGKIIGVYLGRPFEGWPYDKIKSELGYIWY
FT                   YVNNKLKQPLIVTDDDISGTFTFIRALEDYGCSKDLSPEQIGNTWLNYIIENRTILWWG
FT                   GLGNSTEHTAYLRLKQGLKPPQSGSIETNSKVVAEQIGAQIFIDGWGMVSPGDPEMAAD
FT                   LARRAACVSHDGEAIYAAQVIAAIEAQAFVEDNIEKLIDCGISFIPQDSTIYRLITDIR
FT                   NWYTAYDDWEQTRELIEQKYGYDKYGGGCHVVPNHALIINALLYGKGDFQKSLMIVNTS
FT                   GWDTDCNSGNVGCILGIKNGLEGIDLGPDWRSPLADRMYIASADGGRVVTDAVRESYRI
FT                   ANIGRRLVGMEAVSPKGGARFHFEAPGALQGFYVDKSDGCCQTVSIRNSAIEQLHGNRA
FT                   LELEFAHICPGQSARALTPTFIPPDDLDMPGYRLMASPQLYPGQTIRASFLASDISGEA
FT                   NLSLIVKTYRSDGSTELFKSRSIPLMPRQQATIDWRVPNINNQTIYAVGVEISSDRYSS
FT                   GRVYLDYLTWEGVPSANLIFPDEQNSRLPWIDAVDHVLYPPSGGIALIQDKDTGLFLQG
FT                   CDDWRGYTLRASISIHMAEAAGLAFRARGINRYYALLLKPRSGRVELISRFDDHISVLH
FT                   SFEKKLELDRYYDITISIKDDTVYVTLENEAFEYRLSNTFLRSGFIGLVCTEGRVDCKA
FT                   LSITT"
     MSLPEDYLER VYAGVLGKII GVYLGRPFEG WPYDKIKSEL GYIWYYVNNK LKQPLIVTDD        60
     DISGTFTFIR ALEDYGCSKD LSPEQIGNTW LNYIIENRTI LWWGGLGNST EHTAYLRLKQ       120
     GLKPPQSGSI ETNSKVVAEQ IGAQIFIDGW GMVSPGDPEM AADLARRAAC VSHDGEAIYA       180
     AQVIAAIEAQ AFVEDNIEKL IDCGISFIPQ DSTIYRLITD IRNWYTAYDD WEQTRELIEQ       240
     KYGYDKYGGG CHVVPNHALI INALLYGKGD FQKSLMIVNT SGWDTDCNSG NVGCILGIKN       300
     GLEGIDLGPD WRSPLADRMY IASADGGRVV TDAVRESYRI ANIGRRLVGM EAVSPKGGAR       360
     FHFEAPGALQ GFYVDKSDGC CQTVSIRNSA IEQLHGNRAL ELEFAHICPG QSARALTPTF       420
     IPPDDLDMPG YRLMASPQLY PGQTIRASFL ASDISGEANL SLIVKTYRSD GSTELFKSRS       480
     IPLMPRQQAT IDWRVPNINN QTIYAVGVEI SSDRYSSGRV YLDYLTWEGV PSANLIFPDE       540
     QNSRLPWIDA VDHVLYPPSG GIALIQDKDT GLFLQGCDDW RGYTLRASIS IHMAEAAGLA       600
     FRARGINRYY ALLLKPRSGR VELISRFDDH ISVLHSFEKK LELDRYYDIT ISIKDDTVYV       660
     TLENEAFEYR LSNTFLRSGF IGLVCTEGRV DCKALSITT                              699
//

If you have problems or comments...

PBIL Back to PBIL home page