(data stored in ACNUC7421 zone)

EMBL: CP001854.PE1

CP001854.PE1         Location/Qualifiers
FT   CDS             80..1441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: pca:Pcar_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48437"
FT                   /db_xref="GOA:D3EYP9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP9"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADB48437.1"
FT                   /translation="MHTQLEHTWSQIQAELRRAVTDSTYHLWLAPLKARSLDGDVLMVG
FT                   APEEIRTWVADRFARVLQTCAAAVISPATTIVVVPLDAPLPAEADARPAAPPPRPSEAK
FT                   ADESFNPKYTFDQFVIGDGNRLAHAAALAVAELPGQAYNPLFIYGPPGLGKTHLLHAIA
FT                   NYVRSYGDGMTVRYTTIEAFTNRFITALRSSSVEEFKRRYRDTDILLIDDVQFLQSKAK
FT                   TEEEFFHTFNALYETGSQLVVTCDRMPRDMNALAERLRERFESGLVTDIRAPDLATRMT
FT                   ILRKRVQHDGVQLASPDAIEPIADRITTNIRALQGALIRVVAFHSLTGRPIDRALVTHV
FT                   LDGLYPGARPQQRTLAEIQEATCERLGVSPEALRSPDRSARVAWARQVAMYLARELTDE
FT                   TLPAIGRAFGGRNHTTVMHACRRASERIAADAEAYELVRALTARLQQPDADRGS"
     MHTQLEHTWS QIQAELRRAV TDSTYHLWLA PLKARSLDGD VLMVGAPEEI RTWVADRFAR        60
     VLQTCAAAVI SPATTIVVVP LDAPLPAEAD ARPAAPPPRP SEAKADESFN PKYTFDQFVI       120
     GDGNRLAHAA ALAVAELPGQ AYNPLFIYGP PGLGKTHLLH AIANYVRSYG DGMTVRYTTI       180
     EAFTNRFITA LRSSSVEEFK RRYRDTDILL IDDVQFLQSK AKTEEEFFHT FNALYETGSQ       240
     LVVTCDRMPR DMNALAERLR ERFESGLVTD IRAPDLATRM TILRKRVQHD GVQLASPDAI       300
     EPIADRITTN IRALQGALIR VVAFHSLTGR PIDRALVTHV LDGLYPGARP QQRTLAEIQE       360
     ATCERLGVSP EALRSPDRSA RVAWARQVAM YLARELTDET LPAIGRAFGG RNHTTVMHAC       420
     RRASERIAAD AEAYELVRAL TARLQQPDAD RGS                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page