(data stored in ACNUC7421 zone)

EMBL: CP001854.PE10

CP001854.PE10        Location/Qualifiers
FT   CDS             complement(11814..12941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48446"
FT                   /db_xref="GOA:D3EYP2"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48446.1"
FT                   /translation="MSFFDEADEPRTTPRPRRAPSGGGSRRPPTDEQTLLVRRLVAAGA
FT                   VVVVLVLMVVLVRGCVGSRREQALKDYNRDVRTLVQQSVRSVSDRLFETLSGAGGQQAE
FT                   QVNEAINQLRVVAEDQLQQAEALDVPGSAKEAQSDLELVLSLRHDGVREIAEQIQTALG
FT                   NSPQSGAAVDAITAQMQAFNASDVVYSQRVAPLILKALKDDGIAASYDGTAGEQVAPYS
FT                   QFLPNVSWMDASNVARALGTSSASADETGRPAPGLHGHQIDSVSVGGTALEPGTSVTLP
FT                   ASPAPTFEVAFTNGGEHDEQNVRVVVEISVGGATPLRAETTVPSTTAGEPATANVEFRE
FT                   SPPTTGAAEVRVTIEPVPGEEGLDNNTATYTALFE"
     MSFFDEADEP RTTPRPRRAP SGGGSRRPPT DEQTLLVRRL VAAGAVVVVL VLMVVLVRGC        60
     VGSRREQALK DYNRDVRTLV QQSVRSVSDR LFETLSGAGG QQAEQVNEAI NQLRVVAEDQ       120
     LQQAEALDVP GSAKEAQSDL ELVLSLRHDG VREIAEQIQT ALGNSPQSGA AVDAITAQMQ       180
     AFNASDVVYS QRVAPLILKA LKDDGIAASY DGTAGEQVAP YSQFLPNVSW MDASNVARAL       240
     GTSSASADET GRPAPGLHGH QIDSVSVGGT ALEPGTSVTL PASPAPTFEV AFTNGGEHDE       300
     QNVRVVVEIS VGGATPLRAE TTVPSTTAGE PATANVEFRE SPPTTGAAEV RVTIEPVPGE       360
     EGLDNNTATY TALFE                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page