(data stored in ACNUC7421 zone)

EMBL: CP001854.PE100

CP001854.PE100       Location/Qualifiers
FT   CDS             complement(97286..98143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0100"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: glo:Glov_1002
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48536"
FT                   /db_xref="GOA:D3F4V8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADB48536.1"
FT                   /translation="MAFFEHDGQRIAYAEHGAGPRAVVLLPGLLFSQRMQEPLAEALAA
FT                   RGNRVITMDPLGHGRSDRPRDMWRYSMSSFGGQVIGLLDHLELEQAVVGGASLGANVTL
FT                   EVAAAAPERLRGMVLEMPVLDNALLGCAIGFTPLLVSLTFGEPAMKLVQHVAKRVPRSP
FT                   LPFIPEILLDWVSQDPGPSAAVLQGLFFGRIAPHRDVRRTFKTPSLVIGHRRDPIHPFS
FT                   DADMLVQELEHGRLLNADSILELRTHPERLTGEIGDFLDECWRPRRAARRRAPRSRARP
FT                   RATA"
     MAFFEHDGQR IAYAEHGAGP RAVVLLPGLL FSQRMQEPLA EALAARGNRV ITMDPLGHGR        60
     SDRPRDMWRY SMSSFGGQVI GLLDHLELEQ AVVGGASLGA NVTLEVAAAA PERLRGMVLE       120
     MPVLDNALLG CAIGFTPLLV SLTFGEPAMK LVQHVAKRVP RSPLPFIPEI LLDWVSQDPG       180
     PSAAVLQGLF FGRIAPHRDV RRTFKTPSLV IGHRRDPIHP FSDADMLVQE LEHGRLLNAD       240
     SILELRTHPE RLTGEIGDFL DECWRPRRAA RRRAPRSRAR PRATA                       285
//

If you have problems or comments...

PBIL Back to PBIL home page