(data stored in ACNUC7421 zone)

EMBL: CP001854.PE101

CP001854.PE101       Location/Qualifiers
FT   CDS             complement(98156..98974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0101"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   dma:DMR_30730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48537"
FT                   /db_xref="GOA:D3F4V9"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4V9"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB48537.1"
FT                   /translation="MSVTGETDLREAPAPDPGFAIRFLDAGNALRGIRALKPVMLELLA
FT                   LRRGMHVLELGCGAGDDVRAFGRRVGSAGRVLGIDEAPSMVEEAARRSHGRNLPVEFQV
FT                   GDALALDLPDATFDRVRIERLLMHVDGEPATVLRESARVLRDGGRIVVFDFDWDALVIE
FT                   GADRELTRRIVRSYADAIRNGSVGRALPRLLNEAGFTSVSTVPHGVAIPYDFFGWLVSS
FT                   HLDEALAAGLFTPEELIAWWDELDRAHAAGGFFAALLGFVAAGTKAPAAG"
     MSVTGETDLR EAPAPDPGFA IRFLDAGNAL RGIRALKPVM LELLALRRGM HVLELGCGAG        60
     DDVRAFGRRV GSAGRVLGID EAPSMVEEAA RRSHGRNLPV EFQVGDALAL DLPDATFDRV       120
     RIERLLMHVD GEPATVLRES ARVLRDGGRI VVFDFDWDAL VIEGADRELT RRIVRSYADA       180
     IRNGSVGRAL PRLLNEAGFT SVSTVPHGVA IPYDFFGWLV SSHLDEALAA GLFTPEELIA       240
     WWDELDRAHA AGGFFAALLG FVAAGTKAPA AG                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page