(data stored in ACNUC7421 zone)

EMBL: CP001854.PE102

CP001854.PE102       Location/Qualifiers
FT   CDS             complement(98971..99840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0102"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: maq:Maqu_2428
FT                   haloalkane dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48538"
FT                   /db_xref="GOA:D3F4W0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W0"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADB48538.1"
FT                   /translation="MRTPEDRFAGLPDFPFEAHYRELDGLRLAHLDEGDGPPVLLMHGE
FT                   PTWSFLWRHAVAPLRDAGYRAIVPDHAGFGRSDKPTELEWYSYDRHTSIAAELLERLDL
FT                   RDVTVVVHDWGGPIGLRLAVEQPERIARIVVTDTGLFTGRQRMTPAWEAFRGFVEATED
FT                   LPIGMLVRGGCHRDPGDAVVAAYDAPFPDAASKAGARAFPLLIPRTPDEAGAATGQRTL
FT                   DALAADTRPTLVLWAEHDPIIPLRTGERFAQAIGAEVAHVVPDASHFLQEDQGPLVGRL
FT                   IVEWLGST"
     MRTPEDRFAG LPDFPFEAHY RELDGLRLAH LDEGDGPPVL LMHGEPTWSF LWRHAVAPLR        60
     DAGYRAIVPD HAGFGRSDKP TELEWYSYDR HTSIAAELLE RLDLRDVTVV VHDWGGPIGL       120
     RLAVEQPERI ARIVVTDTGL FTGRQRMTPA WEAFRGFVEA TEDLPIGMLV RGGCHRDPGD       180
     AVVAAYDAPF PDAASKAGAR AFPLLIPRTP DEAGAATGQR TLDALAADTR PTLVLWAEHD       240
     PIIPLRTGER FAQAIGAEVA HVVPDASHFL QEDQGPLVGR LIVEWLGST                   289
//

If you have problems or comments...

PBIL Back to PBIL home page