(data stored in ACNUC7421 zone)

EMBL: CP001854.PE103

CP001854.PE103       Location/Qualifiers
FT   CDS             100056..102044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0103"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase central
FT                   region; Transketolase domain protein; KEGG: dal:Dalk_2752
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48539"
FT                   /db_xref="GOA:D3F4W1"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W1"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ADB48539.1"
FT                   /translation="MATTAQSTEQLAVDTIRTLAMDAVQNTGNGHPGMPMGMAPVGYLL
FT                   FSEVMRHNPTDPHWPDRDRFVLSAGHGSMLLYACLHLSGYDVTMDDIKHFRQWGSRTPG
FT                   HPEVHHTPGVETTTGPLGQGFANAVGMAIAERFLREHFGAEVQDHRIYGICSDGDLMEG
FT                   VSAEAASLAGHLGLGHLIFLYDHNHISIDGHTSLTFDTEDVNERFDAYGWHTQDVDDVT
FT                   DLDALRAAIAAAQQETGRPSLIRVRSKIGYPAPNKQDTPGAHGAALGEDEVRATKEVMG
FT                   WDPDQHFVVPDGVYDLFSAVEDGKRHQAAWEERYQSWRAADGERATRWDLAWAGKPLPG
FT                   LDAALPQFDPADKPSLATRSAGGTTLQTIARFLPTMVGGSADLNESVKTGIAADGPYSR
FT                   EQATRNVYWGIREHAMGAAVNGLALHGGIVKPYGGTFLQFADYMRPALRLSALMHLPVV
FT                   WVYTHDSVALGEDGPTHQPVEHLAALRAIPGLTLIRPSDANETAEAWRVAVEDVDGPVV
FT                   LVLTRQNVPTLERPPYAPAKGIDKGAYVLADADDAVATIVGTGSEVSVALGARDLLAAE
FT                   GVAARVVAMPSWELFEAQDQAYRDEVLPPGQPKVAVEAGIAMGWERWVDATVSIERFGA
FT                   SAAGEKILEEYGITAAAVAERVRSLLT"
     MATTAQSTEQ LAVDTIRTLA MDAVQNTGNG HPGMPMGMAP VGYLLFSEVM RHNPTDPHWP        60
     DRDRFVLSAG HGSMLLYACL HLSGYDVTMD DIKHFRQWGS RTPGHPEVHH TPGVETTTGP       120
     LGQGFANAVG MAIAERFLRE HFGAEVQDHR IYGICSDGDL MEGVSAEAAS LAGHLGLGHL       180
     IFLYDHNHIS IDGHTSLTFD TEDVNERFDA YGWHTQDVDD VTDLDALRAA IAAAQQETGR       240
     PSLIRVRSKI GYPAPNKQDT PGAHGAALGE DEVRATKEVM GWDPDQHFVV PDGVYDLFSA       300
     VEDGKRHQAA WEERYQSWRA ADGERATRWD LAWAGKPLPG LDAALPQFDP ADKPSLATRS       360
     AGGTTLQTIA RFLPTMVGGS ADLNESVKTG IAADGPYSRE QATRNVYWGI REHAMGAAVN       420
     GLALHGGIVK PYGGTFLQFA DYMRPALRLS ALMHLPVVWV YTHDSVALGE DGPTHQPVEH       480
     LAALRAIPGL TLIRPSDANE TAEAWRVAVE DVDGPVVLVL TRQNVPTLER PPYAPAKGID       540
     KGAYVLADAD DAVATIVGTG SEVSVALGAR DLLAAEGVAA RVVAMPSWEL FEAQDQAYRD       600
     EVLPPGQPKV AVEAGIAMGW ERWVDATVSI ERFGASAAGE KILEEYGITA AAVAERVRSL       660
     LT                                                                      662
//

If you have problems or comments...

PBIL Back to PBIL home page