(data stored in ACNUC7421 zone)

EMBL: CP001854.PE104

CP001854.PE104       Location/Qualifiers
FT   CDS             102150..102641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: net:Neut_1851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48540"
FT                   /db_xref="InterPro:IPR025325"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48540.1"
FT                   /translation="MSEATVVGSAPDLVPGSVSLRGDAAAWDRLEQQVAWYDARSRHSQ
FT                   RWFKLLKVCQIVIAAAIPVVAGAGGDGWRWPVAIGGATIVVLEGLQQLFQYQQNWSTYR
FT                   STCERLKHEKFLYAAGAGPYAGASRPGAMLAERVEGLVSQEHAAWASVQRHRQDEERTA
FT                   "
     MSEATVVGSA PDLVPGSVSL RGDAAAWDRL EQQVAWYDAR SRHSQRWFKL LKVCQIVIAA        60
     AIPVVAGAGG DGWRWPVAIG GATIVVLEGL QQLFQYQQNW STYRSTCERL KHEKFLYAAG       120
     AGPYAGASRP GAMLAERVEG LVSQEHAAWA SVQRHRQDEE RTA                         163
//

If you have problems or comments...

PBIL Back to PBIL home page