(data stored in ACNUC7421 zone)

EMBL: CP001854.PE105

CP001854.PE105       Location/Qualifiers
FT   CDS             102638..103825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_1196 PASTA"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48541"
FT                   /db_xref="GOA:D3F4W3"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48541.1"
FT                   /translation="MSAAAPKVFLSYRREETAGHAGRLYDAIATRFGDANVFMDVELAP
FT                   GIDFVDRITEAVGECRALLVVIGPRWASVTAAGRPQPRIAEPGDYVRLEVETALARSDV
FT                   RVIPVLVAGARMPPPAQLPPSLQGLARRNAIELSDLRWRYDVGRLSDTLGELVAGASAD
FT                   DEGEPHAIAATAARSGPAAARSGPAAAPQTGSASLVLLLLEAIALAAAAGMLARLLAEP
FT                   IHADALASDAEHIATLVLRRAVTWAIVGAVLGVWLSVRRGERSQTVGRLLGGFVLGAAA
FT                   GALGGAIFGAAVILPAEPVAREVADRISIGAMAATGAVLGAAIGALWTPRRVAVGLLAG
FT                   AAGGVVVQLLRNQLGQPSDVVAVGFQCVGIVGFAVSAQLFLDVRAAAVSRQPVRA"
     MSAAAPKVFL SYRREETAGH AGRLYDAIAT RFGDANVFMD VELAPGIDFV DRITEAVGEC        60
     RALLVVIGPR WASVTAAGRP QPRIAEPGDY VRLEVETALA RSDVRVIPVL VAGARMPPPA       120
     QLPPSLQGLA RRNAIELSDL RWRYDVGRLS DTLGELVAGA SADDEGEPHA IAATAARSGP       180
     AAARSGPAAA PQTGSASLVL LLLEAIALAA AAGMLARLLA EPIHADALAS DAEHIATLVL       240
     RRAVTWAIVG AVLGVWLSVR RGERSQTVGR LLGGFVLGAA AGALGGAIFG AAVILPAEPV       300
     AREVADRISI GAMAATGAVL GAAIGALWTP RRVAVGLLAG AAGGVVVQLL RNQLGQPSDV       360
     VAVGFQCVGI VGFAVSAQLF LDVRAAAVSR QPVRA                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page