(data stored in ACNUC7421 zone)

EMBL: CP001854.PE106

CP001854.PE106       Location/Qualifiers
FT   CDS             complement(103800..105287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0106"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bxe:Bxe_B2926 putative transglycolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48542"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W4"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADB48542.1"
FT                   /translation="MPTTRRRRTSPASPSPSRLRLLLAALVLVGVVALVLTQRDGGGGG
FT                   DAEPLPSAGRAAGSGHDPFAFDPSRAELFEQRAAFGTAHPLYTKSPGGAIASAERVARL
FT                   RPLIDQATEGTDVDPDTLEAMVFLESAGRPDAIAGGTDLAGAVGLTQILAETGTSMLGM
FT                   RVDVAASTRLTRRLQRAVNRGDDARAARLAAERRRVDERFDPRKALAGTIRYLDFARER
FT                   LGRDDLTVVSYHMGVGNLENAIEAFGGGRPSWTELYFGSSPTQNPEVWRLFAGLGDESS
FT                   LYYWKVRAARDLMALYRSDPEALDKLAALQTAKASNENVLHPPAAGEAFADGGALRAAY
FT                   DDGRLVRLPTNAGELGLRIDRQMGELAGRVGQPRALYRGLRPDALRLLVEIAAGTRRIS
FT                   GVDAPLTVTSTVRDQRYQEQLAGGNPEATHAFSVHTTGWSFDILRRYANDRQALALQFM
FT                   LDRLQTLGLIAWVREPAAIHVTVAGDAVRFMRGQAGG"
     MPTTRRRRTS PASPSPSRLR LLLAALVLVG VVALVLTQRD GGGGGDAEPL PSAGRAAGSG        60
     HDPFAFDPSR AELFEQRAAF GTAHPLYTKS PGGAIASAER VARLRPLIDQ ATEGTDVDPD       120
     TLEAMVFLES AGRPDAIAGG TDLAGAVGLT QILAETGTSM LGMRVDVAAS TRLTRRLQRA       180
     VNRGDDARAA RLAAERRRVD ERFDPRKALA GTIRYLDFAR ERLGRDDLTV VSYHMGVGNL       240
     ENAIEAFGGG RPSWTELYFG SSPTQNPEVW RLFAGLGDES SLYYWKVRAA RDLMALYRSD       300
     PEALDKLAAL QTAKASNENV LHPPAAGEAF ADGGALRAAY DDGRLVRLPT NAGELGLRID       360
     RQMGELAGRV GQPRALYRGL RPDALRLLVE IAAGTRRISG VDAPLTVTST VRDQRYQEQL       420
     AGGNPEATHA FSVHTTGWSF DILRRYANDR QALALQFMLD RLQTLGLIAW VREPAAIHVT       480
     VAGDAVRFMR GQAGG                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page