(data stored in ACNUC7421 zone)

EMBL: CP001854.PE107

CP001854.PE107       Location/Qualifiers
FT   CDS             105517..105798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0107"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: dol:Dole_0936 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48543"
FT                   /db_xref="GOA:D3F4W5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADB48543.1"
FT                   /translation="MHHKRTSRTPVSAEHVVLGRAVRELRARRDLSQEQLGFHSGLHRN
FT                   YVGAIERGEINPTFKTLLSLVRGLDLPLSELVLLYEHCRAERHGRRHG"
     MHHKRTSRTP VSAEHVVLGR AVRELRARRD LSQEQLGFHS GLHRNYVGAI ERGEINPTFK        60
     TLLSLVRGLD LPLSELVLLY EHCRAERHGR RHG                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page