(data stored in ACNUC7421 zone)

EMBL: CP001854.PE108

CP001854.PE108       Location/Qualifiers
FT   CDS             105828..106691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0108"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   tdn:Suden_1355 site-specific DNA- methyltransferase
FT                   (adenine-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48544"
FT                   /db_xref="GOA:D3F4W6"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W6"
FT                   /inference="protein motif:PFAM:PF01555"
FT                   /protein_id="ADB48544.1"
FT                   /translation="MRVLSTGELPERIELGGEDLVVHGDNLDVLPLLPDGAFDMIYIDP
FT                   PFNTGKAQRRRTLVFEPDVEGDRTGFGGRRYRSQLLQALAYGDTFDDYLGFVAPRLEHA
FT                   RRLLAEHGTLYFHIDYREAHYCKLLLDEIFGRDCFLNEIIWAYDYGGKPRSRWPAKHDT
FT                   ILVYVRTPGAHHFDAEAVDREPYMAPGLVTPEKVARGKRPTDVWWHTIVPTNGYEKTGY
FT                   PTQKPAGVVRRMVAASSRPGGWCLDFFAGSGTLGAVAAGLGRRYVLVDSHAEAIDVMRK
FT                   RLGTAE"
     MRVLSTGELP ERIELGGEDL VVHGDNLDVL PLLPDGAFDM IYIDPPFNTG KAQRRRTLVF        60
     EPDVEGDRTG FGGRRYRSQL LQALAYGDTF DDYLGFVAPR LEHARRLLAE HGTLYFHIDY       120
     REAHYCKLLL DEIFGRDCFL NEIIWAYDYG GKPRSRWPAK HDTILVYVRT PGAHHFDAEA       180
     VDREPYMAPG LVTPEKVARG KRPTDVWWHT IVPTNGYEKT GYPTQKPAGV VRRMVAASSR       240
     PGGWCLDFFA GSGTLGAVAA GLGRRYVLVD SHAEAIDVMR KRLGTAE                     287
//

If you have problems or comments...

PBIL Back to PBIL home page