(data stored in ACNUC7421 zone)

EMBL: CP001854.PE109

CP001854.PE109       Location/Qualifiers
FT   CDS             complement(106711..107400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0109"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; SMART: regulatory protein GntR HTH; KEGG:
FT                   bxe:Bxe_B2016 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48545"
FT                   /db_xref="GOA:D3F4W7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W7"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADB48545.1"
FT                   /translation="MVKLPAPRLQPVDDKNLADRVADQLRETIQSGGYAPGERLVERRL
FT                   ASELGVSHIPVREALTRLTEEGLVERLPRRGCRVAAVSAKDLRDLSSLRVLLEQYVAER
FT                   AQENWTPRAERSLRELVAQMEAAADRGDTSRLSDLDVRFHEQLWALTDHEILVDLVSQL
FT                   RGRISGFLRAATNALEPEALRAHAASHGELIDAIASGKSGKARRAMAKHVEDAAKRLQE
FT                   NAPPEAG"
     MVKLPAPRLQ PVDDKNLADR VADQLRETIQ SGGYAPGERL VERRLASELG VSHIPVREAL        60
     TRLTEEGLVE RLPRRGCRVA AVSAKDLRDL SSLRVLLEQY VAERAQENWT PRAERSLREL       120
     VAQMEAAADR GDTSRLSDLD VRFHEQLWAL TDHEILVDLV SQLRGRISGF LRAATNALEP       180
     EALRAHAASH GELIDAIASG KSGKARRAMA KHVEDAAKRL QENAPPEAG                   229
//

If you have problems or comments...

PBIL Back to PBIL home page