(data stored in ACNUC7421 zone)

EMBL: CP001854.PE11

CP001854.PE11        Location/Qualifiers
FT   CDS             13057..15213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0011"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: scl:sce0850 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48447"
FT                   /db_xref="GOA:D3EYP3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP3"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADB48447.1"
FT                   /translation="MEHRNVTGGDASTVRLRGEGPRPPDAAPLVLERYRLLRQLGAGAF
FT                   GTVWLAHDERLARDVAVKAIALDHASGRAEQEARAAARLAHPAIVTLYEAGTEDGSTYL
FT                   VTELVRGGTLAELLAEGALSDRDVAEVGIALCQGLAHAHAQGVVHRDVKPSNVLVPDAP
FT                   HAGGPVAKLTDFGVARIVEGAGGDALTRTGDVVGTLAYMAPEQAEGREAGAPADLYAAA
FT                   LVLYEALSGVNPIRGGTAVATARRLGATLPPLERQRRDLPPDLCDAIDRALLPRPGERG
FT                   TVAHLHRALRAALPQLGDEPGTVEAPHVERFATAVTQVAERGRQGWRRRSREQELAEVA
FT                   AELGAGAGAWTVHDRRGAATREADRAGAAGERRGLLGRRDGDGAGGRRGLFRGRDAGDE
FT                   RFEDVDGRAVAPGQRRMRSPLLLGHALPGLAGGAVVAVGLSVVPVAADVTVPSPLLAGA
FT                   LAAVAVGLLPRIGWLACVAVLLSWLAGPAGAPGTALVVAAGVAVIPPLLPFGGRSWSLP
FT                   FAAPLLGAAMLAGAYPAVAGQARTVWRRAALGALGFWLLALAEPLARTTLFYGRARGTQ
FT                   PLPRWDDSLDGAIDHALRPLLESGMLATAALWAAGAAVLPWLVRGRRAAIDLIAATLWA
FT                   AALAAGASAIGGTLDGRVPHPDPRGAALGAAAAVFVAIAARAVRAARARRHDENDVPRA
FT                   GGGVVAAPGVGRRRWPAADPEALP"
     MEHRNVTGGD ASTVRLRGEG PRPPDAAPLV LERYRLLRQL GAGAFGTVWL AHDERLARDV        60
     AVKAIALDHA SGRAEQEARA AARLAHPAIV TLYEAGTEDG STYLVTELVR GGTLAELLAE       120
     GALSDRDVAE VGIALCQGLA HAHAQGVVHR DVKPSNVLVP DAPHAGGPVA KLTDFGVARI       180
     VEGAGGDALT RTGDVVGTLA YMAPEQAEGR EAGAPADLYA AALVLYEALS GVNPIRGGTA       240
     VATARRLGAT LPPLERQRRD LPPDLCDAID RALLPRPGER GTVAHLHRAL RAALPQLGDE       300
     PGTVEAPHVE RFATAVTQVA ERGRQGWRRR SREQELAEVA AELGAGAGAW TVHDRRGAAT       360
     READRAGAAG ERRGLLGRRD GDGAGGRRGL FRGRDAGDER FEDVDGRAVA PGQRRMRSPL       420
     LLGHALPGLA GGAVVAVGLS VVPVAADVTV PSPLLAGALA AVAVGLLPRI GWLACVAVLL       480
     SWLAGPAGAP GTALVVAAGV AVIPPLLPFG GRSWSLPFAA PLLGAAMLAG AYPAVAGQAR       540
     TVWRRAALGA LGFWLLALAE PLARTTLFYG RARGTQPLPR WDDSLDGAID HALRPLLESG       600
     MLATAALWAA GAAVLPWLVR GRRAAIDLIA ATLWAAALAA GASAIGGTLD GRVPHPDPRG       660
     AALGAAAAVF VAIAARAVRA ARARRHDEND VPRAGGGVVA APGVGRRRWP AADPEALP         718
//

If you have problems or comments...

PBIL Back to PBIL home page