(data stored in ACNUC7421 zone)

EMBL: CP001854.PE110

CP001854.PE110       Location/Qualifiers
FT   CDS             107536..108315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0110"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   vap:Vapar_1509 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48546"
FT                   /db_xref="GOA:D3F4W8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB48546.1"
FT                   /translation="MDTASESPGASSRRRALVTGASSGIGAAAAAALAAGGCDVWLTYA
FT                   RDEQGAAATADEVRRHGAEAHVSRLDLGDAGAIERLLDEVAGRWGELNVLVNNGGVCPY
FT                   TPADEISVAEWDAVLETNARGTFLALRGALPLLRAAAGDRSVVNVSSVAGELGGVATSV
FT                   HYAASKAAILAITRSYARLLAAEGIRVNAVAPGPVRSGITGKLSDEAAAGLTGATPLGR
FT                   FGQPHEVASAIALLASPAAGFTTGATYDVNGGVRIDG"
     MDTASESPGA SSRRRALVTG ASSGIGAAAA AALAAGGCDV WLTYARDEQG AAATADEVRR        60
     HGAEAHVSRL DLGDAGAIER LLDEVAGRWG ELNVLVNNGG VCPYTPADEI SVAEWDAVLE       120
     TNARGTFLAL RGALPLLRAA AGDRSVVNVS SVAGELGGVA TSVHYAASKA AILAITRSYA       180
     RLLAAEGIRV NAVAPGPVRS GITGKLSDEA AAGLTGATPL GRFGQPHEVA SAIALLASPA       240
     AGFTTGATYD VNGGVRIDG                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page