(data stored in ACNUC7421 zone)

EMBL: CP001854.PE111

CP001854.PE111       Location/Qualifiers
FT   CDS             108308..108658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0111"
FT                   /product="steroid delta-isomerase domain-containing
FT                   protein"
FT                   /note="KEGG: pfl:PFL_4892 steroid delta-isomerase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48547"
FT                   /db_xref="GOA:D3F4W9"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4W9"
FT                   /inference="similar to AA sequence:KEGG:PFL_4892"
FT                   /protein_id="ADB48547.1"
FT                   /translation="MADAEQVFRAQVDAFNARDLDAFLGTYAPDAALHGLLPDRVVNGH
FT                   DEMREIYAARFRQDPLHCTIHATTVYGDRWVAAHERVLGPSGTVELVGVFEVVDGRIVR
FT                   ADMTGRIPVSGD"
     MADAEQVFRA QVDAFNARDL DAFLGTYAPD AALHGLLPDR VVNGHDEMRE IYAARFRQDP        60
     LHCTIHATTV YGDRWVAAHE RVLGPSGTVE LVGVFEVVDG RIVRADMTGR IPVSGD           116
//

If you have problems or comments...

PBIL Back to PBIL home page