(data stored in ACNUC7421 zone)

EMBL: CP001854.PE112

CP001854.PE112       Location/Qualifiers
FT   CDS             108727..110301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0112"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: oan:Oant_1288 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48548"
FT                   /db_xref="GOA:D3F4X0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X0"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADB48548.1"
FT                   /translation="MRWKRTVAAATVACALAVAGCGGDSSSTSGDSGGDTSTGDTPAQV
FT                   AQGGTLTVAHTDGIPQLNPVIRTFGWEEVLFPLLWNGLSKADENGDVVPDIARSWSASP
FT                   DQRTWTFELRTDVRYSNGRPLTSRNVVKAFEYYLDPRTTTQEANKIATIASVRADGPAR
FT                   VVVQLREPNALFPEAIVWVKIVDVDNVGQIDKRPVVTGPYTVKDFVPDDHVTLVPNPEY
FT                   WGDPAPLREMEIVKATDTTSALGALRAGDIDVIWATNPTDVASLEGDPDLKTVEPEVPS
FT                   KYVDWEFDTTAPPFDNVKARQAVAYAVDREAVLQSAYYGLGDLAPTNNPLSTNNPYYGG
FT                   ELTDYSYDLDKARALFEEAGIRAGDTITWWGTAGTNAEWTTAAEIVQASLREIGIELKI
FT                   ENREISTWADKFYPAGKRFPNFLVPNLASFPPSPADAFGFYRRGRCECNWDNPEFESAY
FT                   DAALAEPDETKAKEKWATVQEIVNREVPLIIPLQVKVVSSMRSNVEGVWMEGGGQLHLE
FT                   QAGVAAE"
     MRWKRTVAAA TVACALAVAG CGGDSSSTSG DSGGDTSTGD TPAQVAQGGT LTVAHTDGIP        60
     QLNPVIRTFG WEEVLFPLLW NGLSKADENG DVVPDIARSW SASPDQRTWT FELRTDVRYS       120
     NGRPLTSRNV VKAFEYYLDP RTTTQEANKI ATIASVRADG PARVVVQLRE PNALFPEAIV       180
     WVKIVDVDNV GQIDKRPVVT GPYTVKDFVP DDHVTLVPNP EYWGDPAPLR EMEIVKATDT       240
     TSALGALRAG DIDVIWATNP TDVASLEGDP DLKTVEPEVP SKYVDWEFDT TAPPFDNVKA       300
     RQAVAYAVDR EAVLQSAYYG LGDLAPTNNP LSTNNPYYGG ELTDYSYDLD KARALFEEAG       360
     IRAGDTITWW GTAGTNAEWT TAAEIVQASL REIGIELKIE NREISTWADK FYPAGKRFPN       420
     FLVPNLASFP PSPADAFGFY RRGRCECNWD NPEFESAYDA ALAEPDETKA KEKWATVQEI       480
     VNREVPLIIP LQVKVVSSMR SNVEGVWMEG GGQLHLEQAG VAAE                        524
//

If you have problems or comments...

PBIL Back to PBIL home page