(data stored in ACNUC7421 zone)

EMBL: CP001854.PE113

CP001854.PE113       Location/Qualifiers
FT   CDS             110307..111269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0113"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mes:Meso_1505
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48549"
FT                   /db_xref="GOA:D3F4X1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48549.1"
FT                   /translation="MLGFVIRRAATSILMLVAASVLVFVILRLLPGDPIITRLGATAGA
FT                   NPEAIDQLRREAGLEDPILQQYFDWVGGVLSGDFGQSYFSQFSVTELISRRIGATLELT
FT                   GVAIFFSLLIAVPAAVFCSLRRGSWFDRLVTTGSTVGMALPQFLLGILLILVFAVELRW
FT                   LPARGYVPFNEDPAENVKRMILPALTLAIAAAPLILRYLRASMIEVLDSSYIRTAEGKG
FT                   VPHRRVVVSHALRNALIPGLTMLGMIVGYTLGGVVIVEYVFGIPGLGSLAVESVFKRDY
FT                   AVLQSVVLLISALFIFTTLVVDVLYGVLDPRLRGGGAHG"
     MLGFVIRRAA TSILMLVAAS VLVFVILRLL PGDPIITRLG ATAGANPEAI DQLRREAGLE        60
     DPILQQYFDW VGGVLSGDFG QSYFSQFSVT ELISRRIGAT LELTGVAIFF SLLIAVPAAV       120
     FCSLRRGSWF DRLVTTGSTV GMALPQFLLG ILLILVFAVE LRWLPARGYV PFNEDPAENV       180
     KRMILPALTL AIAAAPLILR YLRASMIEVL DSSYIRTAEG KGVPHRRVVV SHALRNALIP       240
     GLTMLGMIVG YTLGGVVIVE YVFGIPGLGS LAVESVFKRD YAVLQSVVLL ISALFIFTTL       300
     VVDVLYGVLD PRLRGGGAHG                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page