(data stored in ACNUC7421 zone)

EMBL: CP001854.PE114

CP001854.PE114       Location/Qualifiers
FT   CDS             111262..112128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0114"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dda:Dd703_0951
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48550"
FT                   /db_xref="GOA:D3F4X2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48550.1"
FT                   /translation="MASPAFPLGLRLTGRRRSPRRRSAVTVAALAVLGLIVLLCAVGPL
FT                   LADDPSTIDNANRFAGPGTANWFGTDELGRDLFARVVDGGRISLGIAAGATVVSMLLGA
FT                   LWGFAAALGRGLLDELLMRLADVTMAIPQLLFALVFVAAFGATTAGLALIVGVLLTPVT
FT                   ARMIRSAVLSELQSDYTQAAVAYGATRSRLVLREVLPNISAPLGVQAAINAANAIVLEA
FT                   ALSFVGLGVQPPEASWGTLLQQGYQKMYQSTTGVIFPALAIFLTIWMLNLLADQLGGTD
FT                   DLRGRTG"
     MASPAFPLGL RLTGRRRSPR RRSAVTVAAL AVLGLIVLLC AVGPLLADDP STIDNANRFA        60
     GPGTANWFGT DELGRDLFAR VVDGGRISLG IAAGATVVSM LLGALWGFAA ALGRGLLDEL       120
     LMRLADVTMA IPQLLFALVF VAAFGATTAG LALIVGVLLT PVTARMIRSA VLSELQSDYT       180
     QAAVAYGATR SRLVLREVLP NISAPLGVQA AINAANAIVL EAALSFVGLG VQPPEASWGT       240
     LLQQGYQKMY QSTTGVIFPA LAIFLTIWML NLLADQLGGT DDLRGRTG                    288
//

If you have problems or comments...

PBIL Back to PBIL home page