(data stored in ACNUC7421 zone)

EMBL: CP001854.PE115

CP001854.PE115       Location/Qualifiers
FT   CDS             112125..113132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0115"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bph:Bphy_4502 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48551"
FT                   /db_xref="GOA:D3F4X3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X3"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADB48551.1"
FT                   /translation="MSETTDTVTDAVLDVRDLRVAFGPIEPVRGVSFSLRRGERLGLVG
FT                   ESGSGKSLTALAIMRLARRAQLSGQVLLEGEDLLTLKPRQMEKVRGGRVAMVYQDPMSA
FT                   LNPVQTVGHQLEEAIRLHSRLDRRGARERAIELLDGVGVPHPQRRVEQYPHEFSGGMRQ
FT                   RVMIAMAMCADPAVLICDEPTTALDVTTQARIMDLLDRLVEDHGTAVMLITHDLGVAAG
FT                   FCDSIQVMYGGRIVERAEAEALYRAPVHPYSEALLGAAVDLSLELGVPIPTIGGQPPLA
FT                   GRLPSGCSFHPRCPHAQDVCRTDSPALESAAGRPVACHFADARAQTLEESDVRV"
     MSETTDTVTD AVLDVRDLRV AFGPIEPVRG VSFSLRRGER LGLVGESGSG KSLTALAIMR        60
     LARRAQLSGQ VLLEGEDLLT LKPRQMEKVR GGRVAMVYQD PMSALNPVQT VGHQLEEAIR       120
     LHSRLDRRGA RERAIELLDG VGVPHPQRRV EQYPHEFSGG MRQRVMIAMA MCADPAVLIC       180
     DEPTTALDVT TQARIMDLLD RLVEDHGTAV MLITHDLGVA AGFCDSIQVM YGGRIVERAE       240
     AEALYRAPVH PYSEALLGAA VDLSLELGVP IPTIGGQPPL AGRLPSGCSF HPRCPHAQDV       300
     CRTDSPALES AAGRPVACHF ADARAQTLEE SDVRV                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page