(data stored in ACNUC7421 zone)

EMBL: CP001854.PE116

CP001854.PE116       Location/Qualifiers
FT   CDS             113119..113973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0116"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: scl:sce3461 oligopeptide ABC
FT                   transporter ATP- binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48552"
FT                   /db_xref="GOA:D3F4X4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB48552.1"
FT                   /translation="MSVSEATAAAPLVVADGLVKRFRLGRGEELTALDDVSLEIRRGET
FT                   FGLVGESGSGKSTVSRALLALLPLDGGSVRFDGVDVHALGRGDLRALRRRMQMVFQDPF
FT                   AALNRRQSVAQIVAAPLEAHGVGDRASRAQRVAEVLDLVGLGESYRERRPREMSGGQCQ
FT                   RVAIARALALDPDFVVLDESVSALDVSIQAQILNLLNELQQRLGLTYLFISHDLAVVRY
FT                   MASTVAVMQRGSIVERGTREQLFRAAEHDYTRQLMQAIPAVDPAAERARRRAARTAAAA
FT                   GAQ"
     MSVSEATAAA PLVVADGLVK RFRLGRGEEL TALDDVSLEI RRGETFGLVG ESGSGKSTVS        60
     RALLALLPLD GGSVRFDGVD VHALGRGDLR ALRRRMQMVF QDPFAALNRR QSVAQIVAAP       120
     LEAHGVGDRA SRAQRVAEVL DLVGLGESYR ERRPREMSGG QCQRVAIARA LALDPDFVVL       180
     DESVSALDVS IQAQILNLLN ELQQRLGLTY LFISHDLAVV RYMASTVAVM QRGSIVERGT       240
     REQLFRAAEH DYTRQLMQAI PAVDPAAERA RRRAARTAAA AGAQ                        284
//

If you have problems or comments...

PBIL Back to PBIL home page