(data stored in ACNUC7421 zone)

EMBL: CP001854.PE117

CP001854.PE117       Location/Qualifiers
FT   CDS             complement(113967..114698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0117"
FT                   /product="Acetoacetate decarboxylase"
FT                   /EC_number="4.1.1.4"
FT                   /note="PFAM: Acetoacetate decarboxylase; KEGG: mlo:mlr2399
FT                   acetoacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48553"
FT                   /db_xref="GOA:D3F4X5"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X5"
FT                   /inference="protein motif:PRIAM:4.1.1.4"
FT                   /protein_id="ADB48553.1"
FT                   /translation="MTFDPRTITSTPHGAPLVPRLPLRLRRTEILTVVYETDPSAADAL
FT                   VPEPLELAAPRVLVNVYWMHDAEFFGVYGESAVQLPVRLPDGSPAMYSPLLVLDSDAAV
FT                   AAGRELYGQPKKAGNVTLRPHGDLLVGRVERNSIDVITLTMCWKQQACAPDVLEPLVPG
FT                   SGTNVNLRVLPADGDDVTRELVVRDFEDVVVHECWTGPATIELRPNAQVPAHLLPVREV
FT                   RAATHRLVDLTLPPGRVIHRY"
     MTFDPRTITS TPHGAPLVPR LPLRLRRTEI LTVVYETDPS AADALVPEPL ELAAPRVLVN        60
     VYWMHDAEFF GVYGESAVQL PVRLPDGSPA MYSPLLVLDS DAAVAAGREL YGQPKKAGNV       120
     TLRPHGDLLV GRVERNSIDV ITLTMCWKQQ ACAPDVLEPL VPGSGTNVNL RVLPADGDDV       180
     TRELVVRDFE DVVVHECWTG PATIELRPNA QVPAHLLPVR EVRAATHRLV DLTLPPGRVI       240
     HRY                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page