(data stored in ACNUC7421 zone)

EMBL: CP001854.PE118

CP001854.PE118       Location/Qualifiers
FT   CDS             complement(114702..115718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0118"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: ypb:YPTS_1412 D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48554"
FT                   /db_xref="GOA:D3F4X6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X6"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADB48554.1"
FT                   /translation="MTPSDLRPRGVVVVTDSDLPTEGVAERVLEAAGWTVRRAACRTAD
FT                   DVREAAAGAVALIVQWAPVDASVLANLPDCRFVSRLGIGYDMIDVAAATEAGIPVANVP
FT                   DYCVEEVAAHTLAFVFSLTRRLPQLDAGLRAGRWAASDDGDGARRPQGTTVAVLGHGRI
FT                   GARVAQQAASVGFDVLVHDPHVPAERVEAAGHVAVTLDEALERADVVSLHVPLTPQTRH
FT                   LLDAPALARMRPGSALVNTCRGGLVDETALADALRSGQLGAAALDVFESEPLPADSPLR
FT                   DAPNLLLSPHAAWYSPIALLELEERAAQQVADFLDGRPVPTIVNPGYARVRADGAPV"
     MTPSDLRPRG VVVVTDSDLP TEGVAERVLE AAGWTVRRAA CRTADDVREA AAGAVALIVQ        60
     WAPVDASVLA NLPDCRFVSR LGIGYDMIDV AAATEAGIPV ANVPDYCVEE VAAHTLAFVF       120
     SLTRRLPQLD AGLRAGRWAA SDDGDGARRP QGTTVAVLGH GRIGARVAQQ AASVGFDVLV       180
     HDPHVPAERV EAAGHVAVTL DEALERADVV SLHVPLTPQT RHLLDAPALA RMRPGSALVN       240
     TCRGGLVDET ALADALRSGQ LGAAALDVFE SEPLPADSPL RDAPNLLLSP HAAWYSPIAL       300
     LELEERAAQQ VADFLDGRPV PTIVNPGYAR VRADGAPV                               338
//

If you have problems or comments...

PBIL Back to PBIL home page