(data stored in ACNUC7421 zone)

EMBL: CP001854.PE119

CP001854.PE119       Location/Qualifiers
FT   CDS             115804..117189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0119"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_4362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48555"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48555.1"
FT                   /translation="MRTVAAPGFAGWIGVARRDVTPPPGIAQNAWGPATERRSTGVHRP
FT                   LTLTALALRDGADAAPLVLVALDGSWWRAREDEWHVREAVLAAAGGDEARAIVTLSHSH
FT                   SAPLLTRDARDFPGGELVAPYLDALRIAAAEATRDALAATVPATLTWSTGRSAVAGARD
FT                   LTVDGRPLIGWNPDAEADDTLLAGRVTAADGTVLATLVNYACHPTTLAWQNTLTSPDYV
FT                   GALRETVEDATGGAPCLFLLGAAGELAPRDQYTGDVAVADRHGRAVGHAALAALEQLPP
FT                   PGVALALHPAVESGAPLAPWWPVEHAWPDRLATTVEAFDMPLKPQPTVAELEQRWAEID
FT                   PLSRAERLRRAALMRETFGDGPAVPWRVWVWQLGGALVVAQSGEAYSLFQRELRRRFPD
FT                   RAVVVLNLANWSGPAYLPPRELYARDDAYTVWQTPLAAGCLETAIEAAAAGAARLTDEE
FT                   TVR"
     MRTVAAPGFA GWIGVARRDV TPPPGIAQNA WGPATERRST GVHRPLTLTA LALRDGADAA        60
     PLVLVALDGS WWRAREDEWH VREAVLAAAG GDEARAIVTL SHSHSAPLLT RDARDFPGGE       120
     LVAPYLDALR IAAAEATRDA LAATVPATLT WSTGRSAVAG ARDLTVDGRP LIGWNPDAEA       180
     DDTLLAGRVT AADGTVLATL VNYACHPTTL AWQNTLTSPD YVGALRETVE DATGGAPCLF       240
     LLGAAGELAP RDQYTGDVAV ADRHGRAVGH AALAALEQLP PPGVALALHP AVESGAPLAP       300
     WWPVEHAWPD RLATTVEAFD MPLKPQPTVA ELEQRWAEID PLSRAERLRR AALMRETFGD       360
     GPAVPWRVWV WQLGGALVVA QSGEAYSLFQ RELRRRFPDR AVVVLNLANW SGPAYLPPRE       420
     LYARDDAYTV WQTPLAAGCL ETAIEAAAAG AARLTDEETV R                           461
//

If you have problems or comments...

PBIL Back to PBIL home page