(data stored in ACNUC7421 zone)

EMBL: CP001854.PE12

CP001854.PE12        Location/Qualifiers
FT   CDS             15240..15998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0012"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: afw:Anae109_2456 FHA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48448"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP4"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADB48448.1"
FT                   /translation="MSVFKSLESKIAGLVEGTFSRAFRSEVRPVEIARKLAREMEEHKS
FT                   LSVSRVYVPNEYAVYLSPADRERFADLEGELVQELGGYLLEHARRERFALMSRPLIEFR
FT                   TDDRLRLGEFGIQARLVKSAAEPAAVPSQGESGHTMVYSAAERLQEPLEERARQRASTA
FT                   LLVTDGKRMVVGPAGATIGRSRDCDVVLGDANVSRKHAEVRPRGDGWMIHDLGSTNGVT
FT                   VNGTRIEQAQLLRSGDRVEIGTTLLTFELE"
     MSVFKSLESK IAGLVEGTFS RAFRSEVRPV EIARKLAREM EEHKSLSVSR VYVPNEYAVY        60
     LSPADRERFA DLEGELVQEL GGYLLEHARR ERFALMSRPL IEFRTDDRLR LGEFGIQARL       120
     VKSAAEPAAV PSQGESGHTM VYSAAERLQE PLEERARQRA STALLVTDGK RMVVGPAGAT       180
     IGRSRDCDVV LGDANVSRKH AEVRPRGDGW MIHDLGSTNG VTVNGTRIEQ AQLLRSGDRV       240
     EIGTTLLTFE LE                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page