(data stored in ACNUC7421 zone)

EMBL: CP001854.PE120

CP001854.PE120       Location/Qualifiers
FT   CDS             117186..117935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0120"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: lch:Lcho_1203 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48556"
FT                   /db_xref="GOA:D3F4X8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB48556.1"
FT                   /translation="MSGQTAVITGASSGIGRATARHLAAQGWAVASFDVSPPAEPDPAI
FT                   EDHVVDVADNAAVDAAMRSVAERHGGLQLAVNNAGITKRARLEDLTFEEWDAVVGVNLH
FT                   GAFNGTQAAGRIMLAQDGGGSIVNIVSVAADRGQPGRAPYGATKAGIVGLTKTAAVEWA
FT                   TRGVRVNAVGPGYVSSGVYEAALASGQLDNDEVLGRIPMRRLAEADEIASVIAFLASPA
FT                   ASYVTGHVLYADGGFLADFGIGVVGID"
     MSGQTAVITG ASSGIGRATA RHLAAQGWAV ASFDVSPPAE PDPAIEDHVV DVADNAAVDA        60
     AMRSVAERHG GLQLAVNNAG ITKRARLEDL TFEEWDAVVG VNLHGAFNGT QAAGRIMLAQ       120
     DGGGSIVNIV SVAADRGQPG RAPYGATKAG IVGLTKTAAV EWATRGVRVN AVGPGYVSSG       180
     VYEAALASGQ LDNDEVLGRI PMRRLAEADE IASVIAFLAS PAASYVTGHV LYADGGFLAD       240
     FGIGVVGID                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page