(data stored in ACNUC7421 zone)

EMBL: CP001854.PE121

CP001854.PE121       Location/Qualifiers
FT   CDS             117935..119113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0121"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bpe:BP1161 putative racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48557"
FT                   /db_xref="GOA:D3F4X9"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X9"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ADB48557.1"
FT                   /translation="MSDAIREVRVATVALPLPRPLKLGSMEIVAREYAAATVTTEDGLS
FT                   GRAYCLTRNAPVQALVERLVTPHVVGRSSAAVEQRWDEVQRANVAVARSGVAMRALGLV
FT                   DVALWDVRAQRAGVPLWRLLAEHEGGAGAAAGGDSPGATGPRGGSAAAPDGSAPALLVA
FT                   AYPTPDRTPADVAAEVLAGAGRGFRRVKISRDPDPARMRELIERIVAGLPGDCGLVADC
FT                   GFVWRDAEQALAEIAQWGEPPLAWLEDPLVPEDADGCARIRRDGPFPLGVGDEVTEPRT
FT                   YAALLDAGALDVLRLDVLAVGGVTPSLGVLARARDAGVEVSFHVYPEISVHLAAAQPRP
FT                   AWVELFDAEVPGGNPYDPAHLLVAGDPPLRDGRWVASDRPGLGLAFDEERVR"
     MSDAIREVRV ATVALPLPRP LKLGSMEIVA REYAAATVTT EDGLSGRAYC LTRNAPVQAL        60
     VERLVTPHVV GRSSAAVEQR WDEVQRANVA VARSGVAMRA LGLVDVALWD VRAQRAGVPL       120
     WRLLAEHEGG AGAAAGGDSP GATGPRGGSA AAPDGSAPAL LVAAYPTPDR TPADVAAEVL       180
     AGAGRGFRRV KISRDPDPAR MRELIERIVA GLPGDCGLVA DCGFVWRDAE QALAEIAQWG       240
     EPPLAWLEDP LVPEDADGCA RIRRDGPFPL GVGDEVTEPR TYAALLDAGA LDVLRLDVLA       300
     VGGVTPSLGV LARARDAGVE VSFHVYPEIS VHLAAAQPRP AWVELFDAEV PGGNPYDPAH       360
     LLVAGDPPLR DGRWVASDRP GLGLAFDEER VR                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page