(data stored in ACNUC7421 zone)

EMBL: CP001854.PE122

CP001854.PE122       Location/Qualifiers
FT   CDS             119110..119892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0122"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: smd:Smed_1437 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48558"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB48558.1"
FT                   /translation="MSSVVVTGAGTGIGRAIAERLAADGWAVVALEHDAALASELEGVV
FT                   AATVVGDAGDRDDIAAAVTAAEALAPLGGWVNNAGITTQGTLHDPDPEQVRRLLSVNVD
FT                   GVYWGCSAAVRSFTERGAPGAIVNISSIHGRAGAVAHAAYDTSKGAIDALTRHVASAYG
FT                   PYGIRANAIAPGAVMTQALERSFEEADDGAARRAGLERQAPLRRIGEPAEIAAVAAFLL
FT                   SEQASFLTGQSIAVDGGWTTALVPPPLDPELAERYGLR"
     MSSVVVTGAG TGIGRAIAER LAADGWAVVA LEHDAALASE LEGVVAATVV GDAGDRDDIA        60
     AAVTAAEALA PLGGWVNNAG ITTQGTLHDP DPEQVRRLLS VNVDGVYWGC SAAVRSFTER       120
     GAPGAIVNIS SIHGRAGAVA HAAYDTSKGA IDALTRHVAS AYGPYGIRAN AIAPGAVMTQ       180
     ALERSFEEAD DGAARRAGLE RQAPLRRIGE PAEIAAVAAF LLSEQASFLT GQSIAVDGGW       240
     TTALVPPPLD PELAERYGLR                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page