(data stored in ACNUC7421 zone)

EMBL: CP001854.PE123

CP001854.PE123       Location/Qualifiers
FT   CDS             119889..121031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0123"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   afw:Anae109_4188 beta-lactamase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48559"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB48559.1"
FT                   /translation="MSGAAGVAGASGAAGASAVAGVGGAAGAAGAGGVGRIARIVEPLD
FT                   DGRFLSVFLLVGARGAVLVDTGLAATPERTIGPALAARGLGWEDLTAVVVTHADVDHAG
FT                   GLGAVRRLAPQATTICGARDRALIESAELLLERRYREFRADHAIDQSRDFVAWVRANAD
FT                   DGTIDAVFDGDATLTVDDGTVTLARPAGAAPRDDRPPADPARGGPPRDAGAWRVSLLAV
FT                   PGHTAGHLALHDAASGTAIAADAVLGAAAPGADGAPAFAPTYRFLPAYRDTIARLRGLG
FT                   AERLLCSHLEPLDGAAAGAYLDESAAFATALERALLSSLADGREATLAQLIALAAPAVA
FT                   TWPPDANHTLAQPLLGHVEELCARGRIRRRPGLPARYALA"
     MSGAAGVAGA SGAAGASAVA GVGGAAGAAG AGGVGRIARI VEPLDDGRFL SVFLLVGARG        60
     AVLVDTGLAA TPERTIGPAL AARGLGWEDL TAVVVTHADV DHAGGLGAVR RLAPQATTIC       120
     GARDRALIES AELLLERRYR EFRADHAIDQ SRDFVAWVRA NADDGTIDAV FDGDATLTVD       180
     DGTVTLARPA GAAPRDDRPP ADPARGGPPR DAGAWRVSLL AVPGHTAGHL ALHDAASGTA       240
     IAADAVLGAA APGADGAPAF APTYRFLPAY RDTIARLRGL GAERLLCSHL EPLDGAAAGA       300
     YLDESAAFAT ALERALLSSL ADGREATLAQ LIALAAPAVA TWPPDANHTL AQPLLGHVEE       360
     LCARGRIRRR PGLPARYALA                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page