(data stored in ACNUC7421 zone)

EMBL: CP001854.PE124

CP001854.PE124       Location/Qualifiers
FT   CDS             121203..123128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0124"
FT                   /product="Endopygalactorunase-like protein"
FT                   /note="KEGG: Os09g0487600; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48560"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y2"
FT                   /inference="protein motif:COG:COG5434"
FT                   /protein_id="ADB48560.1"
FT                   /translation="MRWSLRGSLLAAAALMLGLPAAASALDVDVTAAPYSAAGDGVTND
FT                   RAAIQRAIGDVASAGGGKVTLPAPKTYLTGNLHLRTNVELHIARGAKVKQSQEITHYAD
FT                   RPLRGALIDETIPWNFTFYRNYPLIYGGSVRNVKLTGAGTIEMTQLPDASQTIRTNAIG
FT                   MWDVSGFEISGIHAIGGTTPYVGLYFNDNGVVRDTTLNEPGGPTVSGIEVVSSQHILVE
FT                   RNLMRDPDGTPGVTDDGIALSTTYGDPRATGWWRSDVPRPLVDVVIRDNIVEAECCSAL
FT                   AFIPWGTSAPDQRDIEFRDIRIENNVLNAPGSWDSVKCWCDNPWRGSYGPAYTAVEDDQ
FT                   APMTNVTFSGNSYAGSLDGFVRARISGIQGASFHPGNPYLKNGGFEETGIAYWSKSGTA
FT                   RQVGAETFAAGQTGRWFGYITNFGDGYTALAQGVGLPASTSYTFRARVQTSGDPVRMYV
FT                   HNQCTGATVAAKWVSGTGWSTEDLSFTTTSACSNYHVGIDSSGQTRGWGRIDDARLLGS
FT                   VIEDGDPRIGYAGLWHQNVHPSDSGGTHMLAVADRTTANVTFEGNRARWRTIVGPNGGY
FT                   ADVWLDGVFKGTVDTYSASYGWAEIYDTGVLSRGTHVLGIRPQWAKNPLSTYTYVTIDA
FT                   INVSGW"
     MRWSLRGSLL AAAALMLGLP AAASALDVDV TAAPYSAAGD GVTNDRAAIQ RAIGDVASAG        60
     GGKVTLPAPK TYLTGNLHLR TNVELHIARG AKVKQSQEIT HYADRPLRGA LIDETIPWNF       120
     TFYRNYPLIY GGSVRNVKLT GAGTIEMTQL PDASQTIRTN AIGMWDVSGF EISGIHAIGG       180
     TTPYVGLYFN DNGVVRDTTL NEPGGPTVSG IEVVSSQHIL VERNLMRDPD GTPGVTDDGI       240
     ALSTTYGDPR ATGWWRSDVP RPLVDVVIRD NIVEAECCSA LAFIPWGTSA PDQRDIEFRD       300
     IRIENNVLNA PGSWDSVKCW CDNPWRGSYG PAYTAVEDDQ APMTNVTFSG NSYAGSLDGF       360
     VRARISGIQG ASFHPGNPYL KNGGFEETGI AYWSKSGTAR QVGAETFAAG QTGRWFGYIT       420
     NFGDGYTALA QGVGLPASTS YTFRARVQTS GDPVRMYVHN QCTGATVAAK WVSGTGWSTE       480
     DLSFTTTSAC SNYHVGIDSS GQTRGWGRID DARLLGSVIE DGDPRIGYAG LWHQNVHPSD       540
     SGGTHMLAVA DRTTANVTFE GNRARWRTIV GPNGGYADVW LDGVFKGTVD TYSASYGWAE       600
     IYDTGVLSRG THVLGIRPQW AKNPLSTYTY VTIDAINVSG W                           641
//

If you have problems or comments...

PBIL Back to PBIL home page