(data stored in ACNUC7421 zone)

EMBL: CP001854.PE125

CP001854.PE125       Location/Qualifiers
FT   CDS             123264..125165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0125"
FT                   /product="Endopygalactorunase-like protein"
FT                   /note="KEGG: Os09g0487600; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48561"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y3"
FT                   /inference="protein motif:COG:COG5434"
FT                   /protein_id="ADB48561.1"
FT                   /translation="MRRLLVSGLVAAVTACLALPAAASALDVDVTAAPYGAAGDGVTND
FT                   RAAIQSAIDDVSAAGGGKVTLPAPRTFLSGDVSVKSNVTLEIAGGATLKMSQNQSHWAH
FT                   RPVLGHMIDGTIEWNIAMYRNYPLIHSGNARNVTVTGGGTIEMTRALTDETTIHAMGIG
FT                   FHKVDGFRISNLTMIGASASNVSLYTVDNGIVSGMTMRDDLDTNVEGVAIGNSQHVRVT
FT                   GNTMDATSDDTIVLWTQWNDPRGTTWWSTAVPEPINDIEIDNNYATSTCCKAIALIPWG
FT                   TAYGDQRQVEMSDVRVHDNTLAATDAVGCWCDDPYTGEPPSRFTNQEQDQAPMKDLTFA
FT                   RNRYTGSTALTKAHIQNLVADFAKTSPTFIRNGGFERTGHAYWSRVSRAGQSDAADYSV
FT                   GQNGSWYGYIQYFDVGYTTLYQGVSLTGGQTYTLRARIQTPDGSPARMYVYDTCGGTGV
FT                   TQNVSSLAWTDVSLRFTAASSCGRYIVGFDSGTFTSGGLRVDDVLLEGPRIDNDDPVIS
FT                   YEGLWYLYERAGDHGGTERMATQAGTRSSATVTFRGTRARVLAVRGGDRGRADVYLDGV
FT                   YKTTIDQYSPTTDLQYVTYDTGTVAAGTHELRVVPTWTKHPASANTVISVDAVEVVR"
     MRRLLVSGLV AAVTACLALP AAASALDVDV TAAPYGAAGD GVTNDRAAIQ SAIDDVSAAG        60
     GGKVTLPAPR TFLSGDVSVK SNVTLEIAGG ATLKMSQNQS HWAHRPVLGH MIDGTIEWNI       120
     AMYRNYPLIH SGNARNVTVT GGGTIEMTRA LTDETTIHAM GIGFHKVDGF RISNLTMIGA       180
     SASNVSLYTV DNGIVSGMTM RDDLDTNVEG VAIGNSQHVR VTGNTMDATS DDTIVLWTQW       240
     NDPRGTTWWS TAVPEPINDI EIDNNYATST CCKAIALIPW GTAYGDQRQV EMSDVRVHDN       300
     TLAATDAVGC WCDDPYTGEP PSRFTNQEQD QAPMKDLTFA RNRYTGSTAL TKAHIQNLVA       360
     DFAKTSPTFI RNGGFERTGH AYWSRVSRAG QSDAADYSVG QNGSWYGYIQ YFDVGYTTLY       420
     QGVSLTGGQT YTLRARIQTP DGSPARMYVY DTCGGTGVTQ NVSSLAWTDV SLRFTAASSC       480
     GRYIVGFDSG TFTSGGLRVD DVLLEGPRID NDDPVISYEG LWYLYERAGD HGGTERMATQ       540
     AGTRSSATVT FRGTRARVLA VRGGDRGRAD VYLDGVYKTT IDQYSPTTDL QYVTYDTGTV       600
     AAGTHELRVV PTWTKHPASA NTVISVDAVE VVR                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page