(data stored in ACNUC7421 zone)

EMBL: CP001854.PE126

CP001854.PE126       Location/Qualifiers
FT   CDS             125170..125922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0126"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   csa:Csal_1825 3-hydroxybutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48562"
FT                   /db_xref="GOA:D3F4Y4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB48562.1"
FT                   /translation="MNADRRPAALVTGAAGGIGGAIVAALGDAGWDVLAVDLRPDPETG
FT                   PGASFAADLTTREGNRAAVEHALDRFGRLDAIVANAGMQHVAPVADFPEDRWDALLALM
FT                   LTSPFLLAKYAWPALAASGDGRIVAVASAHAQVASPFKSAYVSAKHGVLGLVKTLALEG
FT                   AEQGITATAVCPGFVRTPLVEAQIGDQARAHGLPEEDVLRDVILAPHAVKRLLEPEEIA
FT                   ATVAFLLGPAGRAFTGVPVTMDLGWTAR"
     MNADRRPAAL VTGAAGGIGG AIVAALGDAG WDVLAVDLRP DPETGPGASF AADLTTREGN        60
     RAAVEHALDR FGRLDAIVAN AGMQHVAPVA DFPEDRWDAL LALMLTSPFL LAKYAWPALA       120
     ASGDGRIVAV ASAHAQVASP FKSAYVSAKH GVLGLVKTLA LEGAEQGITA TAVCPGFVRT       180
     PLVEAQIGDQ ARAHGLPEED VLRDVILAPH AVKRLLEPEE IAATVAFLLG PAGRAFTGVP       240
     VTMDLGWTAR                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page