(data stored in ACNUC7421 zone)

EMBL: CP001854.PE127

CP001854.PE127       Location/Qualifiers
FT   CDS             complement(126012..128807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0127"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; Collagen triple
FT                   helix repeat; SMART: PKD domain containing protein; KEGG:
FT                   bpt:Bpet2847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48563"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y5"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ADB48563.1"
FT                   /translation="MSLWSTARRAVPTALVAAAAVGAVASAPAAAAPGDPSADVTAAPY
FT                   NAAGDDTTNDRAAIQQAIDDIGARGGGEVIVPAGRTFLTGSLKLRSGVTLRLDGTLRQS
FT                   QDVAHYAKAPIPGLDMPTDIPWHRAYFHNDPLIGAIGVHDVAIVGSGKLQMTVQADHTR
FT                   RIDIIPVGFFEAQRFTLRGITIREARTTIITMLHSSDGLVANNDVATSPDLGADGIVVS
FT                   GSQRVRVLHNRVRTSDDNFVLETKHLDPRDQDSWWSSATSTPLKDIELAYNDAENFGAR
FT                   YSIAFLPWASTPADKRDAAISDIWIHDNRLVSRNDTWVYCDCDNPFNPERRPFIQPTRR
FT                   GEQAPMTRIVMERNTYDGRMWPFYSWVPPVFTDSRFEIARANAPALMNGDFERTAAVWW
FT                   SPEGNAGATDDPAEVPEAAEAAFARRGGSFAAYLETRRNQRAALYQGISLKNAATLQMP
FT                   RLGLGNRAVYTFEANVVTSGHAFALVARDTCANRELARRLVAPRSFRRERLLIPVETNC
FT                   DLVRVGIERTAANGAWALLDDAELHMPVIDSEDPRWVLRGMWMRDWSGWDVGETDHHAG
FT                   DDGGSAALTYTGGQAKLISARKPWGGIVEMSVDGAARGDVDLYGSQQIGGLEVFDTGTL
FT                   SSGRHTLRLTITGRKNAASENDYGIFDAIVVPEWVNPAAPAAHLEELRPDLGAVVVPGR
FT                   ALVGHPVYVEAPAYAPRGGGVTVGWRLGDGTTTSGSKANHVYDAPGTYTVTVEARDTHG
FT                   ETTTATRTIVVRAGPSGLAGLDGAAGADGTDGAPGERGADGPAGPAGAAGATGATGPAG
FT                   ATGAGGPTGARGAAGPKGDAGDPANVSVSCTLVKRRTAVRCTVAATRARARGAARVSGT
FT                   FRTAGTTARAAGSGRVAVTLRPAQRPTKSARVAVRLRVDGIAKDLVVPLGTTRSVALPR
FT                   R"
     MSLWSTARRA VPTALVAAAA VGAVASAPAA AAPGDPSADV TAAPYNAAGD DTTNDRAAIQ        60
     QAIDDIGARG GGEVIVPAGR TFLTGSLKLR SGVTLRLDGT LRQSQDVAHY AKAPIPGLDM       120
     PTDIPWHRAY FHNDPLIGAI GVHDVAIVGS GKLQMTVQAD HTRRIDIIPV GFFEAQRFTL       180
     RGITIREART TIITMLHSSD GLVANNDVAT SPDLGADGIV VSGSQRVRVL HNRVRTSDDN       240
     FVLETKHLDP RDQDSWWSSA TSTPLKDIEL AYNDAENFGA RYSIAFLPWA STPADKRDAA       300
     ISDIWIHDNR LVSRNDTWVY CDCDNPFNPE RRPFIQPTRR GEQAPMTRIV MERNTYDGRM       360
     WPFYSWVPPV FTDSRFEIAR ANAPALMNGD FERTAAVWWS PEGNAGATDD PAEVPEAAEA       420
     AFARRGGSFA AYLETRRNQR AALYQGISLK NAATLQMPRL GLGNRAVYTF EANVVTSGHA       480
     FALVARDTCA NRELARRLVA PRSFRRERLL IPVETNCDLV RVGIERTAAN GAWALLDDAE       540
     LHMPVIDSED PRWVLRGMWM RDWSGWDVGE TDHHAGDDGG SAALTYTGGQ AKLISARKPW       600
     GGIVEMSVDG AARGDVDLYG SQQIGGLEVF DTGTLSSGRH TLRLTITGRK NAASENDYGI       660
     FDAIVVPEWV NPAAPAAHLE ELRPDLGAVV VPGRALVGHP VYVEAPAYAP RGGGVTVGWR       720
     LGDGTTTSGS KANHVYDAPG TYTVTVEARD THGETTTATR TIVVRAGPSG LAGLDGAAGA       780
     DGTDGAPGER GADGPAGPAG AAGATGATGP AGATGAGGPT GARGAAGPKG DAGDPANVSV       840
     SCTLVKRRTA VRCTVAATRA RARGAARVSG TFRTAGTTAR AAGSGRVAVT LRPAQRPTKS       900
     ARVAVRLRVD GIAKDLVVPL GTTRSVALPR R                                      931
//

If you have problems or comments...

PBIL Back to PBIL home page