(data stored in ACNUC7421 zone)

EMBL: CP001854.PE128

CP001854.PE128       Location/Qualifiers
FT   CDS             complement(128870..130204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0128"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="KEGG: ara:Arad_12308 histidinol dehydrogenase;
FT                   TIGRFAM: histidinol dehydrogenase; PFAM: Histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48564"
FT                   /db_xref="GOA:D3F4Y6"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y6"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ADB48564.1"
FT                   /translation="MAEVLKAARDGWTGARTRSGRATSEGGDRANGASDPAVVATVAEI
FT                   IGAVRERGDAAVRELSARFDRWEPESFRLTTEQIDACVAQVSEQALADLRWCQEQVRAF
FT                   ALAQRASLHDVEVETQPGVRLGHRHVPIARVGAYIPGGRYPMIASAAMSILTAKAAGVE
FT                   HVIACTPPLDGAPPALTVAAMQLAGADEIHVLGGVQAVAAMAVGTETIERVDFLAGPGN
FT                   AYVAEAKRQLFGEVGIDLFAGPTEILVVADETADPEIVAADLLGQAEHGLTSPAALIAT
FT                   DAGLARAALAEIERQLQTLPTADVAGPAWRDYGEVHLVGDREEAAALADAFAYEHVEIL
FT                   TAEPRWFLDTLRQYGALFLGEGTTVAYGDKAIGTNHVLPTAGAARYTGGLWVGKFLKTV
FT                   TYQECDPAASARIGEICARQCRLEHFEGHARSCDVRVRKYAGALV"
     MAEVLKAARD GWTGARTRSG RATSEGGDRA NGASDPAVVA TVAEIIGAVR ERGDAAVREL        60
     SARFDRWEPE SFRLTTEQID ACVAQVSEQA LADLRWCQEQ VRAFALAQRA SLHDVEVETQ       120
     PGVRLGHRHV PIARVGAYIP GGRYPMIASA AMSILTAKAA GVEHVIACTP PLDGAPPALT       180
     VAAMQLAGAD EIHVLGGVQA VAAMAVGTET IERVDFLAGP GNAYVAEAKR QLFGEVGIDL       240
     FAGPTEILVV ADETADPEIV AADLLGQAEH GLTSPAALIA TDAGLARAAL AEIERQLQTL       300
     PTADVAGPAW RDYGEVHLVG DREEAAALAD AFAYEHVEIL TAEPRWFLDT LRQYGALFLG       360
     EGTTVAYGDK AIGTNHVLPT AGAARYTGGL WVGKFLKTVT YQECDPAASA RIGEICARQC       420
     RLEHFEGHAR SCDVRVRKYA GALV                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page