(data stored in ACNUC7421 zone)

EMBL: CP001854.PE129

CP001854.PE129       Location/Qualifiers
FT   CDS             130338..131336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0129"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: pol:Bpro_5109 LacI family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48565"
FT                   /db_xref="GOA:D3F4Y7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y7"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADB48565.1"
FT                   /translation="MAVTSRDIAREIGLSQSTVSRALRGDPRVTPATRERVREAAERLR
FT                   YVPDAAARTLTTGRTQIVGVVVADITNPFYPEIVEVLHGELGQEGYATVLLNEPRADDL
FT                   AGQLRGRSVDGLIVVSALLDEQFARQLSRLGMPVVLLNRDVDDTAVDCVVSDNVAGGAL
FT                   AADHLLALGHRRIGLVAGPANTSTARDRERGMRQALAQHGVPLDDSLRRSGSFSHHSGH
FT                   QGCLELLRLPQPPTALVCASDVVAFGALDAAKRLGVAVPERLAVVGYDDVAMAGWEAFS
FT                   LTTIRQPMAQMARRAVQLLMERLRPGTSGEEPQREVFPPHLVKRETTAPPA"
     MAVTSRDIAR EIGLSQSTVS RALRGDPRVT PATRERVREA AERLRYVPDA AARTLTTGRT        60
     QIVGVVVADI TNPFYPEIVE VLHGELGQEG YATVLLNEPR ADDLAGQLRG RSVDGLIVVS       120
     ALLDEQFARQ LSRLGMPVVL LNRDVDDTAV DCVVSDNVAG GALAADHLLA LGHRRIGLVA       180
     GPANTSTARD RERGMRQALA QHGVPLDDSL RRSGSFSHHS GHQGCLELLR LPQPPTALVC       240
     ASDVVAFGAL DAAKRLGVAV PERLAVVGYD DVAMAGWEAF SLTTIRQPMA QMARRAVQLL       300
     MERLRPGTSG EEPQREVFPP HLVKRETTAP PA                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page